KEGG   Nakamurella multipartita: Namu_3076Help
Entry
Namu_3076         CDS       T00991                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nml  Nakamurella multipartita
Pathway
nml00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01130  Biosynthesis of antibiotics
nml01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Namu_3076
Enzymes [BR:nml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Namu_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE OMPdecase
Motif
Other DBs
NCBI-ProteinID: ACV79410
UniProt: C8XBQ6
Position
complement(3392686..3393495)
Genome map
AA seq 269 aa AA seqDB search
MNVLDGILAGVREDLAVREAQVPMADVRAMARNAPPPKPVLPVLLEPGVGVIAEVKRASP
SKGALATIADPAALARTYAEAGARVISVLTEQRRFNGSLADLDAVRAAVDIPVLRKDFIV
SPYQVHEARAHGADLVLLIVAALDQNVLIGLLERVESLGMTALVEIHTEAEADRALAAGA
KVIGVNARDLTTLTIDRDVFARIAPGLPSGVVTVAESGVRGPSDLLAYAGAGADAVLVGE
GLVTSGDPRAALADLVTAGSHPSCPRPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgctggacgggatcctggccggtgttcgtgaggatctcgccgtccgcgaggca
caggtgcccatggccgacgttcgggccatggcccgcaacgcgccgccccccaagcccgtc
ctgccggtgctgctcgaaccgggcgtcggcgtcatcgccgaggtgaagcgggccagcccc
tccaagggggcgctggccaccatcgccgacccggccgcgctggcccgcacctatgccgag
gccggggcccgggtgatctcggtgctcaccgagcagcgccgcttcaacggcagcctggcc
gacctggacgcggtgcgcgccgcggtcgacatcccggtgctgcgcaaggacttcatcgtc
agcccgtaccaggtgcacgaggcccgggcgcacggcgccgacctggtcctgctgatcgtc
gccgcgctggaccagaacgtgctgatcgggctgctcgagcgggtcgaatcgctcggcatg
accgcgctggtcgagatccacaccgaggccgaggccgaccgggcgctggccgccggggcc
aaggtgatcggggtcaacgcccgcgacctgaccaccctgaccatcgaccgggacgtgttt
gcccggatcgctcccgggctaccctcgggcgtggtcaccgtggccgagtccggggtgcgt
ggtccgtccgatctgctggcctacgccggcgccggcgcggacgccgtactggtgggcgag
ggactggtcaccagcggtgacccccgggcggcgctggccgacctggtgaccgccggttcg
cacccgtcctgtccgcgcccgtcccgctga

DBGET integrated database retrieval system