KEGG   Nakamurella multipartita: Namu_3763Help
Entry
Namu_3763         CDS       T00991                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00520  Amino sugar and nucleotide sugar metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_3763
   00520 Amino sugar and nucleotide sugar metabolism
    Namu_3763
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Namu_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACV80061
UniProt: C8XG59
Position
4128700..4129512
Genome map
AA seq 270 aa AA seqDB search
MATNQPDIAFGIDIGGTGIKGGVVDLRGGVLIGERFRLPTPSPSTPEAVAKTAGQVAANF
DYSGPFGVDFPGVVLNGVVQTAANVDKGWIGTSLQQAMEPHLPGPVTVLNDADAAGLAEA
RYGAGRGRRGLVIVVTFGTGIGIALINDGKLVPNAELGHIELDGHDAETKAAASARERDG
LSWEQWAKRASKYLRHLENLLWPELFILGGGISKKPEKWVPLLRNRTPTVVAQLINNAGI
VGAALAASEAQTPAEAAESPAESTQTLILD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccaaccagcccgacatcgctttcggcatcgacatcggtggcaccgggatcaag
ggcggcgtggtcgacctgcgcggcggcgtgctgatcggcgagcgcttccggctgccgacg
cccagcccgtccacccccgaggcggtggccaagaccgccggtcaggtcgccgccaacttc
gactactccggtccgttcggggtcgacttccccggcgtcgtcctgaacggcgtcgtgcag
acggccgcgaacgtggacaagggctggatcggcacctcgctgcagcaggccatggagccg
cacctgccgggtccggtgaccgtgctcaacgacgccgacgcggccgggctggccgaggcc
cgctacggcgccggccggggccggcgcggcctggtcatcgtggtcaccttcggcaccggc
atcggcatcgcgttgatcaacgacggcaagctggtgcccaacgccgagctcgggcacatc
gagctggacgggcacgacgcggagaccaaggcggccgcctcggcccgggagcgcgacggc
ctgagctgggagcagtgggccaagcgggcctccaagtacctgcgccacctggagaacctg
ctctggccggagctgttcatcctcggcggcggcatttccaagaagccggagaagtgggtg
ccgctgctgcgcaaccgcacacccaccgtggtcgcccagctgatcaacaacgccggcatc
gtcggcgccgcgctggccgccagtgaggcccagaccccggccgaagcggccgagtccccg
gccgagtccacccagaccctgatcctggactga

DBGET integrated database retrieval system