KEGG   Nakamurella multipartita: Namu_5109Help
Entry
Namu_5109         CDS       T00991                                 

Definition
(GenBank) cytochrome P450
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
nml  Nakamurella multipartita
Pathway
nml00071  Fatty acid degradation
nml00380  Tryptophan metabolism
nml00627  Aminobenzoate degradation
nml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Namu_5109
  Amino acid metabolism
   00380 Tryptophan metabolism
    Namu_5109
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Namu_5109
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Namu_5109
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Namu_5109
Cytochrome P450 [BR:nml00199]
 Cytochrome P450, bacteria type
  CYP102 family
   Namu_5109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-ProteinID: ACV81379
UniProt: C8XB87
Position
complement(5695898..5699113)
Genome map
AA seq 1071 aa AA seqDB search
MTAPISVDQLPGPHGVPILGNLLDLNNPHPIDTLMDWARQYGPIYKLTVPGTTRIVVSGA
DLMPDICDDERFDKQLGPGLVAARGTGTPGLFLSETSDPLWRRAHNILMAPFSQSSMRGY
LPRMVDIAGQLMDKWSRLNPDDEVNVPADMTALTLDTIALCGFGYRFNSLYRDTPHPFVA
AMVRNLLEAQKEAKELPLQRKLRVQARRQAREDSEFQINLVKGLIEDRRRQGDAADNTDL
LGRMLTGVDKSSGEGLPDDNIIAQCMTFLVAGHETTSGLLSFAINYLMKSPQYIDQARVQ
IDEVLGDTAEPTYEQVHQLTFVRQILDESLRLWPTAPMFTRAARTDTVIGGKYLAPKDVG
ISVLLPMLHRDPSVWGPDAEDFNPHHFDPERFAAVPPLAYRPFGTGLRACIGRQFALQEA
TLVLGMLLQRFDIIDHRNYQLHTRATLTVKPEDMWIRLRPREGFAGVARAQAAVTGAADE
GPAEADASAVATAHGTPLLVLFGSNLGTAEGIANRLGREGADRGYAVTVAALDDHGPDLP
AEGAVLVVSASYNGEAPENAAAFVDKLRSRAVPDGAYAGVRFTVFGCGDTDWAATYQAVP
ILLDAELERLGGTRIHPRGAGDAQADFDGQYRAWHADLWADLAAGLGLSERQAQVTAAGP
RLTIATVNRQLTNPVVVSYDATPTLVTRNVELTATGAAGVRSTRHVEVALPAGLSYRAGD
HLGVLPRNNQAQIRRVMRRFGLDMGTYVTITANSGTHTHLPVDEPSPLLGVLGACVELQA
TATRADLEVLAEHTDDPAQQAALRALTDDETYRTQVREPNLSVLDLLERYPACALPFPVF
LDLLPALAPRYYSISSSPLASPDTVCVTEGVLAEPARSGAGRFEGVCSTYLASMDAGSTV
FVFTREPTIPFRPPADPSVPMIMVGAGTGLAPFRGFLQERAAQGADGAALAPSLLFFGCR
TRDDRLYEQELADFATSASVQTYTAFSREPGQQRRYAQHEMLAHADEIWSLLEAGGVVYV
CGNARTLAPGVRAALTQIAADKLGLGGAAAEDWLTDLRRQHRYLEDIWGAR
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccatctccgtcgatcagctgcccggcccgcacggtgtgccgatcctgggc
aacctgctggatctgaacaacccgcacccgatcgacacgctgatggactgggcccgccag
tacggcccgatctacaagctgaccgttcccggcaccacccggatcgtcgtctccggtgcc
gacctgatgcccgacatctgcgacgacgaacggttcgacaagcaactcgggcccgggctg
gtcgccgcgcggggcaccgggacgccggggctgttcctgtccgagaccagcgatccgctc
tggcggcgggcgcacaacatcctgatggccccgttcagccagtccagcatgcgcggctac
ctgccgcggatggtcgacatcgccggccagctgatggacaagtggtcgcggctcaacccc
gatgatgaggtgaacgtgccggccgacatgaccgcgctcaccctggacacgatcgccctg
tgcgggttcggctaccgcttcaactcgctctaccgggataccccgcacccgttcgtggcg
gccatggtccgcaacctgctggaggcgcagaaggaggccaaggaactgccgctgcagcgc
aagctccgggtgcaggcccgccggcaggcccgcgaggacagcgagttccagatcaacctg
gtcaagggtctgatcgaggaccgccggcggcagggcgacgcggccgacaacaccgacctg
ctcggccggatgctcaccggggtggacaagtccagcggcgaggggctgccggacgacaac
atcatcgcccagtgcatgacgttcctggtggccggccacgagaccaccagcggcctgctc
tcgttcgccatcaactacctgatgaaaagcccgcagtacatcgaccaggcgcgggtgcag
atcgacgaggtgctcggggacaccgccgagccgacgtacgagcaggtgcaccagctgacc
ttcgtccggcagatcctggacgagtcgctgcggctgtggccgaccgcgccgatgttcacc
cgggcggcccggacggacaccgtcatcggcgggaagtacctcgcgcccaaggatgtcggg
atctcggtgctgctgccgatgttgcaccgcgaccccagcgtgtgggggccggacgccgag
gacttcaacccgcatcacttcgacccggagcggttcgccgcggtgccgccgctggcctac
cggccgttcggcaccgggctgcgcgcgtgcatcggtcgccagttcgccctgcaggaggcc
actttggtgctcggcatgctgctgcagcgcttcgacatcatcgaccaccgcaattaccag
ctgcacacccgcgcgaccctgaccgtcaagccggaggacatgtggatccggctgcggccg
cgggagggcttcgccggagtggcgcgggcgcaggccgcggtgacgggtgcggccgacgaa
gggccggccgaggccgacgcgtccgcggtggcgacggcgcacggcacgccgttgctggtg
ctgttcggctccaacctgggcacggccgagggcatcgccaaccggctgggacgggagggc
gccgaccgtgggtacgcggtgacggtggccgctctggacgaccatggacccgacctgccg
gccgaaggtgcggtgctggtggtcagtgcctcctacaacggcgaggcgccggagaacgcg
gccgccttcgtggacaagctgcgcagccgggcggtgcccgacggggcatacgcgggcgtg
cggttcacggtgttcggctgcggcgacaccgactgggcggcgacctatcaggcggtgccg
atcctgctggacgccgagctggaacgcttgggcggcacccggatccaccctcgcggcgcc
ggagatgcgcaggccgacttcgacggccagtaccgggcctggcacgccgacctgtgggcg
gatctggccgccgggctgggcctgtcggagcggcaggcgcaggtgacggcggccgggccg
cggctgacgatcgccacggtgaaccgccagctgaccaacccggtggtcgtgtcctacgac
gcgacgccgaccctggtcacccgcaacgtcgagctgaccgcgaccggggcggccggggtg
cgctcgacccggcacgttgaggtcgccctgccggccgggctgagctaccgggccggcgat
cacctgggcgtgctgccccgcaacaaccaggcccagatccgccgcgtgatgcgacgtttc
ggcctggacatgggcacctacgtgacgatcacggcgaacagtggcacgcacacccacctg
ccggtcgacgagccgtcgccgttgctgggcgtgctcggggcctgcgtcgaactgcaggcg
acggccacccgggccgacctggaggtgctggccgagcacaccgacgacccggcgcagcag
gcggcgttgcgggcgctgaccgacgacgagacctaccggacgcaggtgcgtgagccgaac
ctgtcggtgctcgacctgctggagcgctatccggcctgcgcgctgccgttcccggtgttc
ctggatctgctgccggccctggccccgcggtactactccatctcctcctcgccgctggcc
agtccggacacggtgtgcgtgaccgagggcgtgctggccgagccggcccgatccggcgcc
ggccggttcgagggggtctgctcgacctacctggcgtcgatggacgccggcagcacggtg
ttcgtgttcacccgggagccgaccatcccgttccgcccgccggccgacccgagcgtgccg
atgatcatggtgggggccgggaccgggctcgccccgttccgcgggttcctgcaggaacgc
gccgcccagggtgccgacggggccgcgctggccccgtccctgctgttcttcggctgccgg
acccgcgacgaccggttgtacgagcaggagctggccgacttcgcgacgagtgcgagtgtg
cagacttacacggcattctcgcgcgagccgggccagcagcggcgctacgcccagcacgag
atgctggcccacgcggacgagatctggtcgctgctcgaggccggcggggtggtgtacgtc
tgcggcaacgcccgtaccctggcgcccggcgtgcgcgccgccctgacccagatcgccgcc
gacaagctcggtctcggcggcgccgcggccgaggactggctgaccgacctgcgccgccag
caccggtacctggaggacatctggggtgcccgctga

DBGET integrated database retrieval system