KEGG   Nakamurella multipartita: Namu_5309Help
Entry
Namu_5309         CDS       T00991                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00020  Citrate cycle (TCA cycle)
nml00620  Pyruvate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_5309
   00020 Citrate cycle (TCA cycle)
    Namu_5309
   00620 Pyruvate metabolism
    Namu_5309
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Namu_5309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACV81575
UniProt: C8XD85
Position
complement(5935722..5937197)
Genome map
AA seq 491 aa AA seqDB search
MTSTESTTRPTGRLETFRMPDAGEGLTEADIIGWRVAVGDTVTVNQVIVEIETAKAAVEL
PCPYAGRVHQLLAEPGATVEVGTPIITIDTGTDTGTAPAGDHGAVVEGGPVNGAAAETGS
KIGEVTADGRIATLVGYVPAGRSGGRRARRAAPTGAAAPASRAPAAPVSSPPPVPAEPEP
PAAHATHAAPLATPPVRKLAKDLGIDLHAVAPSRADGVISREDVEHAAAARTRPAAGPDR
EPAPPAARASTRPDDGSREYRIAVTGVRKATAAAMVASAFTAPHVTEFLTVDVTPMMQLR
ERLRTRREFADAPPTPLALTARAVCLAARRTPEINSVYEAGTDGPDQILVKRDVHLGIAA
ATDRGLIVPVIRDADAMGLADLARALQELTATARAGRTSLAQLTGGTFTITNVGVFGVDT
GTPIINPGQSAILALGAIRDAPWVVDGELAVRKVCQLALSFDHRVIDGQQGSQFLADIGA
LLADPGLALAF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgagagcaccacccgaccgaccggccggctcgagaccttccgcatgccg
gacgccggcgaaggcctgaccgaggccgacatcatcggctggcgggtcgccgtcggcgac
accgtcaccgtcaaccaggtcatcgtggagatcgagacggccaaggcggccgtcgaactg
ccctgcccgtacgccggccgggtccaccagctgctcgccgaaccgggcgcgaccgtcgag
gtcgggacgccgatcatcaccatcgacaccggaaccgacaccgggaccgctccggcgggt
gaccacggcgccgtcgtcgagggtggcccggtcaacggcgccgcggccgagaccgggtcc
aagatcggtgaggtgaccgccgacgggcggatcgccacgctggtcggctacgtgccggcc
ggacggtcggggggccgccgcgcccgccgcgccgccccgaccggggcggccgcccccgca
tcacgcgccccggccgcccctgtgtcatcgccgccgccggtcccggccgagccggaaccg
ccggccgcgcacgcgacccacgcggctccgctggccactccgccggtccgcaagctggcc
aaggatctgggtatcgacctgcacgcggtggccccctcccgcgcggacggggtgatcagc
cgggaggacgtcgagcacgccgccgcggcgcggacccggccggccgcgggtccggatcgg
gagccggctccgccggcggcccgcgcgtcgaccaggcccgacgacgggtctcgggagtac
cggatcgcggtgaccggggtgcgcaaggcgaccgccgcggccatggtggccagcgcgttc
accgccccgcacgtgaccgagttcctcaccgttgacgtcaccccgatgatgcagctgcgg
gagcggctgcggacccgccgggaattcgccgacgcgcccccgacgccgctggccctgacc
gcccgcgccgtgtgcctggccgcccggcgcacccccgagatcaattcggtctacgaggcg
ggcaccgacggcccggaccagatcctggtcaagcgggacgtgcacctgggcatcgccgcg
gccaccgaccgcgggctgatcgtgccggtcatccgggacgcggacgcgatgggcctggcc
gacctggcccgggccctgcaggagctcaccgccaccgcccgggccggtcggaccagcctg
gcccagctgaccggcggcaccttcaccatcaccaacgtgggggtgttcggggtggacacc
ggcacgccgatcatcaacccgggccagtcggcgatcctggccctgggcgcgatccgggac
gcgccgtgggtcgtcgacggtgagttggcggtgcgcaaggtatgccagctggcgctcagc
ttcgaccaccgcgtcatcgacgggcagcagggctcgcagttcctggccgacatcggtgcc
ctgctggccgatccggggctggccctggccttctga

DBGET integrated database retrieval system