KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0210Help
Entry
NMBM01240149_0210 CDS       T01930                                 

Gene name
lysA
Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00300  Lysine biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01230  Biosynthesis of amino acids
Module
nmm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMBM01240149_0210 (lysA)
Enzymes [BR:nmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     NMBM01240149_0210 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: ADY96839
Position
241797..243041
Genome map
AA seq 414 aa AA seqDB search
MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAELSPLVCYAVKANGNLSII
KHFASLGSGFDIVSGGELARVLAAGGDATKTIFSGVGKNEAEIEFALNAGVKCFNMESIP
EIDRIQKVAARLGKTASVSLRVNPDVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQ
PNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQDEN
VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN
DLMRPALYDAYHHIEAVETKDIEPLTANIVGPICETGDFLGKDRTIACEEGDLLLIRSAG
AYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQQMANELACLQAEHQNAV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgttttgcgaacaagtcccctacccccgccttgccgaagcattcggcacaccg
ctttatgtgtacagccaatccgcgctgaccgaagcatttgaacactaccaaactgccttt
gccgagctctccccgctcgtctgctatgcggttaaagccaatggcaacctgagcatcatc
aaacactttgcttctttggggagcggttttgacattgtgtccggcggcgaattggcacgc
gttttggcggcaggcggcgacgcgacgaaaacgattttttccggcgtgggcaaaaacgag
gcggaaatcgagttcgcgctgaatgcaggcgtgaaatgcttcaatatggaaagcattccc
gaaatcgaccgtattcaaaaggttgccgcgcgtttgggcaaaaccgcgtccgtctcccta
cgcgtcaatcccgatgtcgatgcgaaaacccatccctacatctccacaggtctgaaagcc
aacaaattcggcattgcctacgccgacgcgctcgaagcctaccgccatgccgcacaacag
cccaatttgaaaatcatcggcatcgactgccacatcggttcgcaactgaccgacttaagc
ccgctggtcgaagcctgcgagcgcattttgattttggttgacgcgcttgccgccgaaggc
attgtgttggaacacttggacttgggcggcggcgtcggcattgtttaccaagacgaaaat
gtgcctgatttgggcgcgtatgcccaagccgttcaaaaactgatcggcacacgccgtctg
aaactcattcttgagcccggccgcagcttggtcggcaacgcaggttcgctgctgacacgc
gtcgaattcgtcaaatacggcgaagagaaaaactttgtgatggtcgatgcggcgatgaac
gatttgatgcgcccggcgctttatgatgcctatcatcacatcgaggcggtcgaaaccaaa
gacattgagcctctgaccgccaacatcgtcggtccgatttgcgaaaccggcgacttcctc
ggcaaagaccgcaccatcgcctgcgaagaaggcgatttgctgcttatccgcagcgcgggc
gcatacggagccagtatggcgagcaattacaacgcgcgcaaccgtgcggcagaggtgttg
gtggacggcaacgaataccgactcatccgccggcgcgaaaccttggaacagcaaatggca
aacgaactcgcctgcctgcaagccgaacatcaaaatgccgtctga

DBGET integrated database retrieval system