KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0372Help
Entry
NMBM01240149_0372 CDS       T01930                                 

Gene name
ribD
Definition
(GenBank) riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00740  Riboflavin metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMBM01240149_0372 (ribD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NMBM01240149_0372 (ribD)
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     NMBM01240149_0372 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     NMBM01240149_0372 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam
Motif
Other DBs
NCBI-ProteinID: ADY96992
Position
complement(417843..418952)
Genome map
AA seq 369 aa AA seqDB search
MFSETDISMMQNALKLAALGRFSTSPNPRVGCVIAQGSQIVGQGFHVKAGEPHAEVHALR
QAGEMAQGATAFVTLEPCSHYGRTPPCAEALLRSGVTRVVAAMRDPNPLVAGKGLALLEA
AGIKTECGLLEHQARELNRGFLSRIERRRPFVRLKCAVSLDGKTALSDGSSFWITGEDAR
ADVQVLRAESCAVLTGIGTVLADNPRLNVRAFPTLRQPARIVLDSRLRLPLDSHLLTDGQ
SPTYIATLERDEDKLRPYREHAHIRILMPSETADGKIDLHRLMRLLADEGYGEVMVEAGA
KLTSAFLAEDLADEIVLYRSPKILGSGKDLFSLPENRAALSAPPLWTPVSTEILGHDVKT
VFRKNGNAF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttttccgaaacagatatttctatgatgcaaaacgccctcaaacttgccgctttgggg
cgtttttccacttcgcccaatccgcgcgtcggctgcgttatcgcacaaggcagccaaatt
gtcggacagggcttccacgtcaaagcgggcgaaccgcacgccgaagtccacgccctgcgt
caggcgggcgaaatggcacaaggcgcgaccgcctttgttaccctcgaaccgtgcagccat
tacggacgcacaccgccctgcgccgaagctctgctccgttccggcgtaacacgcgtcgtt
gccgccatgcgcgaccccaacccgctggttgcaggcaaagggcttgccctgctcgaagca
gcaggcatcaagacggaatgcggtttactcgaacatcaggcaagggaactcaaccgaggc
ttcctgtcgcgcatcgaacgccgccgccccttcgtccgcctcaaatgcgccgtttcgctg
gacggcaaaaccgccctttcagacggcagcagcttttggattaccggcgaagacgcgcgt
gccgacgtacaggttttgcgtgccgaaagctgcgcggtgctgaccggcatcggcacggtg
ttggcggacaatccccggctcaacgtccgcgcttttccaactttgcgccaacccgcacgc
atcgtgttagacagccgcctgcgcctgcccttggacagccaccttctgaccgacggacaa
tctccaacctacatcgccaccttggaacgcgatgaagacaaactccgcccctatcgggaa
cacgcacatatccgcatcctgatgccgtctgaaacggcagacggcaaaatcgacctgcac
cgcctgatgcgcctccttgccgacgaaggatacggcgaagtaatggtggaagccggcgcg
aaactcacatccgcctttttggcggaagatttggcggacgaaatcgtgctgtaccgttcg
cccaaaatcctcggcagcggcaaagacctgttttccctgcccgaaaaccgcgccgccctt
tccgcaccgcccttatggacacccgtttccaccgaaatcctcggacacgacgtcaaaacc
gtattccggaaaaacggcaacgccttttaa

DBGET integrated database retrieval system