KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0389Help
Entry
NMBM01240149_0389 CDS       T01930                                 

Gene name
metK
Definition
(GenBank) methionine adenosyltransferase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00270  Cysteine and methionine metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMBM01240149_0389 (metK)
Enzymes [BR:nmm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     NMBM01240149_0389 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: ADY97009
Position
438779..439948
Genome map
AA seq 389 aa AA seqDB search
MSEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTT
AQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAG
DQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETG
KVKRIDTVVLSTQHDPSIAYEELKNAVIEQIIKPVLPSELLTDETKYLINPTGRFVIGGP
QGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQ
IQVSYAIGVAEPTSISIDTFGTGKISEEKLITLVREHFDLRPKGIVQMLDLLRPIYSKSA
AYGHFGREEPEFTWERTDKAAALRAAAGL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatatctgtttacttccgaatcggtatccgaaggccatccggacaaagttgcc
gaccaagtatccgatgcgattttggatgccatcttggcgcaagaccccaaagcgcgtgtc
gccgcagaaactttggtcaacacaggcttgtgcgtattggcaggcgaaatcaccaccacc
gcccaagtggactacatcaaagtcgcacgcgaaaccatcaaacgcatcggctacaactcc
tccgagctgggctttgatgccaacggctgcgcggtcggcgtgtactacgaccaacaatcc
cccgacatcgcccaaggcgtaaacgaaggcgaaggtatcgacttgaaccaaggcgcaggc
gaccaaggtttgatgttcggttatgcctgcgacgaaaccccgaccctgatgccgtttgcc
atctattacagccaccgcctgatgcaacgccaaagcgaattgcgtaaagacggccgcctg
ccgtggctgcgtcccgacgcaaaagcgcagttgaccgtggtttacgacagcgaaaccggt
aaggtaaaacgcattgataccgtcgtcctctctacccagcacgatccgtccatcgcttac
gaagaactgaaaaacgccgtcatcgagcagattatcaagcccgtcctgccgtctgaactg
ctgaccgacgaaaccaaatacctgatcaacccgaccggccgcttcgtcatcggcggcccg
caaggcgactgcggtttgaccggccgtaaaatcatcgtcgatacctacggcggcgcggct
ccgcacggcggcggcgcgttttccggcaaagacccgtccaaggttgaccgttccgccgcc
tacgcctgccgctatgtggcgaaaaacatcgtcgccgcaggattggcaacccaatgccaa
atccaagtttcctacgccatcggcgttgccgaaccgacttcgatttccatcgacactttc
ggcacaggcaaaatcagcgaggaaaaactgattaccttagttcgcgaacatttcgacctg
cgccccaaaggcatcgtccaaatgctcgatctcttgcgcccgatttacagtaaatccgcc
gcttacggacatttcggccgcgaagaacctgagttcacttgggagcgcaccgacaaagct
gctgcattgagggcggcagcggggctgtaa

DBGET integrated database retrieval system