KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0604Help
Entry
NMBM01240149_0604 CDS       T01930                                 

Gene name
ilvB
Definition
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00290  Valine, leucine and isoleucine biosynthesis
nmm00650  Butanoate metabolism
nmm00660  C5-Branched dibasic acid metabolism
nmm00770  Pantothenate and CoA biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
nmm01210  2-Oxocarboxylic acid metabolism
nmm01230  Biosynthesis of amino acids
Module
nmm_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nmm_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMBM01240149_0604 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    NMBM01240149_0604 (ilvB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMBM01240149_0604 (ilvB)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMBM01240149_0604 (ilvB)
Enzymes [BR:nmm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     NMBM01240149_0604 (ilvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M PPS_PS DUF1614 KdpD POR_N
Motif
Other DBs
NCBI-ProteinID: ADY97201
Position
682274..684001
Genome map
AA seq 575 aa AA seqDB search
MQLSGAQIIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHEQAAVHAADAY
ARVSGKVGVALVTSGPGVTNALTGIATAYTDSIPMVVISGQVGNSLIGTDAFQEVDTVGI
TRPCVKHNFLVTDINELAETIKKAFQIAASGRPGPVVVDVPKDVTQAMAKFSYPQEDIFI
RSYQPVVQGHIGQIKKAVQMLASAKRPVVYFGGGVVLGNASEELTRFVRMTGAPCTGTLM
GLGAYPSGDRQFLGMLGMHGTYEANLAMQNADVVLAVGARFDDRVVSVPSKFFEKAKKVI
HIDVDPSSIAKRVKADIPIVGDVKNVLSEMVALWQKQESVPSEDVLGKWWKTIEEWRSRD
CLWFDNGSEIIKPQYVIQKLAEITGNSAIITSDVGQHQMFAAQYYPFERPRQWLNSGGLG
TMGVGLPYAIGAKLAAPDQDVFCITGDGSIQMNIQELSTCFQYRIPVNVITLNNGYLGMV
RQWQEIYYGGRESETYFDSLPDFVKLAEAYGHIGIRVDKKSDVEGALLEALNQKDRLVFI
DFLTDQKQNVMPMVGNGKGLDEMVLPPHMRADEKA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcagttatcaggcgcgcaaatcatagtgcagagtctcaaagccgaaggtgtcgagtac
gttttcggttatcccggcggtgcggttatcgaaatctacgatgcccttttccaactcaat
aaattcaagcacattctgacccgtcacgagcaggcggcagtacacgcggcagatgcgtat
gcgcgcgtcagcggtaaggtgggcgtggcattggttacatccggcccgggcgttaccaat
gcactgaccggtattgctactgcctatacggattcgattccgatggtggtcatcagcggg
caggtaggcaattccctgattggtacggatgcgttccaagaagttgatacggtgggtatt
acccgtccgtgcgtcaaacacaatttcctggttacggacatcaatgagttggcggaaacc
attaaaaaggcgttccaaattgccgcaagcggccgaccggggcccgtggtggttgatgtc
ccgaaagatgttacgcaggcgatggcgaaattcagctatcctcaggaagacatttttatc
cgttcgtatcaaccggttgttcaagggcatatcggtcagattaaaaaggccgtgcagatg
ttggcatctgccaaacgtccggtcgtctattttggcggcggcgtggtgttgggtaatgct
tctgaagagctgacccgatttgtccgaatgacgggtgctccgtgcacgggtacgctgatg
ggcttgggcgcttatccttccggcgaccgccaattcctcggtatgctcggtatgcacggt
acttacgaggcaaaccttgccatgcagaatgcggatgtcgttcttgccgtaggtgcgcgt
tttgacgaccgtgtggtttccgtaccgtccaaatttttcgagaaggcgaagaaggttatc
catatcgatgtcgatccttccagcatcgccaaacgcgtgaaggcggacattccgattgtc
ggcgacgtgaaaaacgttttgtccgagatggttgcgctgtggcaaaaacaagagtccgtg
ccgtctgaagatgttttgggcaaatggtggaaaaccatagaggaatggcgttcccgcgat
tgcttgtggtttgacaacggcagcgaaattatcaagccacaatatgtgattcagaagctt
gccgagattaccggcaattcggcaatcatcacatcggatgtagggcagcatcaaatgttt
gcggctcaatattatcccttcgaacgtccgcgccaatggctcaactccggcggtttgggt
acgatgggcgttggtctgccttatgcgattggtgcaaaacttgccgccccggatcaagac
gtattctgtattaccggcgacggctcgatccagatgaacatccaagagctgtccacctgt
ttccaatatcggattccggttaacgtcattacgctgaacaacggttatctcggtatggta
cgccagtggcaggaaatatattacggcggccgagagtcggaaacttatttcgattctttg
cccgatttcgtcaaacttgccgaggcatacggtcatatcggcatccgcgtggacaagaag
tctgatgtggaaggtgcgttgttggaagcattgaaccaaaaagacaggctggtgtttatc
gacttcctgaccgaccagaaacagaatgtgatgcccatggtcggtaacggcaaaggtttg
gacgaaatggtacttccgccgcatatgcgtgcggacgaaaaggcgtaa

KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0605Help
Entry
NMBM01240149_0605 CDS       T01930                                 

Gene name
ilvN
Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00290  Valine, leucine and isoleucine biosynthesis
nmm00650  Butanoate metabolism
nmm00660  C5-Branched dibasic acid metabolism
nmm00770  Pantothenate and CoA biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
nmm01210  2-Oxocarboxylic acid metabolism
nmm01230  Biosynthesis of amino acids
Module
nmm_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nmm_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMBM01240149_0605 (ilvN)
   00660 C5-Branched dibasic acid metabolism
    NMBM01240149_0605 (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMBM01240149_0605 (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMBM01240149_0605 (ilvN)
Enzymes [BR:nmm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     NMBM01240149_0605 (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 Queuosine_synth DUF3845
Motif
Other DBs
NCBI-ProteinID: ADY97202
Position
684012..684503
Genome map
AA seq 163 aa AA seqDB search
MRHILSVLIENESGAMSRVVGLFSARDYNIDSLAVAPTEDKTLSRMTIVTHGDEQVIEQI
TKQLNKLIEVIKVVDLNESRFVERELMLVKVRAAGKDRDEFLRLTEIYRGSIIDVTDRSY
TIEITGSTDKLDSFLETVGRAQILETVRTGAAGIGRGERILKI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatatcttatctgttctgattgaaaacgaatcaggtgcgatgagccgcgtggtc
ggtttgttctctgcacgcgattacaatatcgattctttggcggttgcgccgaccgaagac
aaaaccctgtcccgtatgaccatcgttacccacggcgacgagcaggtcatcgaacaaatc
accaagcaactcaataaattgattgaagtgattaaagtggtcgatttgaacgaaagccgt
tttgtcgaacgcgaactgatgttggtaaaagtccgtgccgccggcaaagaccgcgacgaa
tttttacgcttgaccgaaatctaccggggcagcatcatcgacgtaaccgaccgcagctat
acgattgaaattaccggctcgacagacaagctggattcctttttggaaacggtcggacgc
gcccaaattttggaaaccgtacgcacaggcgcggccggcatcggtcgcggtgagcgtatt
ttgaaaatttaa

DBGET integrated database retrieval system