KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0765Help
Entry
NMBM01240149_0765 CDS       T01930                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00010  Glycolysis / Gluconeogenesis
nmm00052  Galactose metabolism
nmm00500  Starch and sucrose metabolism
nmm00520  Amino sugar and nucleotide sugar metabolism
nmm00521  Streptomycin biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_0765 (glk)
   00052 Galactose metabolism
    NMBM01240149_0765 (glk)
   00500 Starch and sucrose metabolism
    NMBM01240149_0765 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM01240149_0765 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM01240149_0765 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NMBM01240149_0765 (glk)
Enzymes [BR:nmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMBM01240149_0765 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADY97355
Position
890432..891418
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGASPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcggc
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcgcgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgcggcggcattattccccgcgtgttggaatatttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
ctcgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system