KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0813Help
Entry
NMBM01240149_0813 CDS       T01930                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00010  Glycolysis / Gluconeogenesis
nmm00020  Citrate cycle (TCA cycle)
nmm00620  Pyruvate metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
Module
nmm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_0813 (aceF)
   00020 Citrate cycle (TCA cycle)
    NMBM01240149_0813 (aceF)
   00620 Pyruvate metabolism
    NMBM01240149_0813 (aceF)
Enzymes [BR:nmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMBM01240149_0813 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Methyltr_RsmB-F DEC-1_N DUF4813
Motif
Other DBs
NCBI-ProteinID: ADY97403
Position
complement(947028..948626)
Genome map
AA seq 532 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGASAAEAAPAVAAEAQPAPAAAPVAAGGATVQVAVPDIGGHT
DVDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGSAIIE
VETAGSVAAAPAQAAQAAAPAPTAAAAPAAAPAPSAPAAAKIDEAAFAKAHAGPSARKLA
RELGVDLGQVKGTGLKGRIVGDDIKAFVKSVMQGGAAKPAAAGASLGSGLDLLPWPKVDF
SKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWEREGVK
LSPLAFIIKASVSALKAFPEFNASLDGDNLMLKNYFNIGFAADTPNGLVVPVIKDVDQKG
LKQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGVCKS
QIKPVWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLAKLLKDFRRITL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaaacgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattacactggaa
accgacaaagccacgatggatgtgcctgccgatgctgccggtgtcgtgaaagaagtaaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattttgaccgttgaaaccggtgcc
tccgccgccgaagccgctccggctgttgccgctgaagcacaacctgcacctgccgccgca
cccgttgccgcaggcggtgcaaccgttcaagtagccgttcccgatatcggcggtcatacc
gatgtggatgtaatcgccgttgaaatcaaagtgggcgacaccgttgccgaagacgacacg
ctgattactttggaaaccgacaaagcgacaatggacgtaccttgtaccgctgccggcgtc
gttaaagccgtattcttaaaagtcggcgacaaagtgtccgaaggctctgccattatcgaa
gtggaaaccgccggctctgtcgcagcagctcctgctcaagccgctcaagctgccgcaccg
gctccgactgctgccgccgcacccgccgccgcgcctgcaccttctgcacctgccgctgcc
aaaatcgacgaggccgctttcgccaaagcacacgccggcccttccgcacgcaaactggcg
cgcgaattgggcgtggatttgggccaagtcaaaggtaccggcttgaaaggccgtatcgtg
ggcgacgacatcaaagcctttgtgaaatccgtaatgcagggtggcgcggcaaaacctgcc
gcagccggcgcatctttgggcagcggtctggacttgctgccgtggcctaaagtggacttc
tccaaattcggcaatgtcgaagttaaagaattgtcccgcattaagaaaatctccggtcaa
aacctgtctcgcaactgggtggtgattccccacgttaccgtacacgaagaagcagatatg
accgagctggaagaattccgcaaacaactgaacaaagaatgggaacgcgaaggcgtgaaa
ctgtctcctctggcgttcatcatcaaagcctccgtttccgcgctgaaagccttccccgaa
ttcaacgcttctctggacggcgacaacctgatgctgaaaaactacttcaacatcggtttc
gcagccgatacgccgaacggcttggttgttcccgtcatcaaagacgtggatcaaaaaggc
ttgaaacaaatcagccaagagctgacagaattgtccaaaaaagcccgcgaaggcaagctc
aaaccacaagaaatgcaaggcgcatgctttaccatttccagcttgggcggcatcggcggc
acaggcttcacgccgattgtgaacgctcccgaagtcgccatcttgggcgtgtgcaaatcc
caaatcaaaccggtttggaacggcaaagagtttgccccgcgcctgatgtgcccgttgagc
ctgtccttcgaccaccgcgtcatcgacggtgcggccggtatgcgcttcaccgtattcttg
gcgaagctgttgaaagacttccgccgcattaccttataa

DBGET integrated database retrieval system