KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0897Help
Entry
NMBM01240149_0897 CDS       T01930                                 

Gene name
leuB
Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00290  Valine, leucine and isoleucine biosynthesis
nmm00660  C5-Branched dibasic acid metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01210  2-Oxocarboxylic acid metabolism
nmm01230  Biosynthesis of amino acids
Module
nmm_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    NMBM01240149_0897 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMBM01240149_0897 (leuB)
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     NMBM01240149_0897 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADY97485
Position
complement(1049021..1050091)
Genome map
AA seq 356 aa AA seqDB search
MTKHIAILRGDGIGPEIVAETVRVLDKLIAQGLDAGYEYAPLGGEAYDEYGHPYPEFTQN
LCRKADAVLLGAVGSPQYDNLDRPLRPERGLLAIRKDLNLFANLRPAVLYPELANASTLK
PEIVAGLDILIVRELTGDIYFGEPRGIRVLENGEREGYNTMKYSESEIRRIAHVAFQSAQ
KRSKKVCSVGKANVLETTELWREIFEEIGKEYPDVELSHMYVDNAAMQLVRAPKQFDVIA
TGNIFGDILSDEASMLTGSIGMLPSASLDENGKGLYEPSHGSAPDIAGQNKANPLATILS
LAMLLRYSLNDEARAQQVENAVQKVLQQGLRTSDIYEEGTKLVSCSEMGDAVLAAL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacatatcgccatcctccgaggtgacggcatcggtcccgaaatcgtcgccgaa
accgtccgcgtactcgacaaactcatcgcccaaggtttggatgccggctacgaatacgcc
ccattgggcggcgaagcctatgacgaatacggtcatccttatcccgaatttacgcaaaac
ctctgccgcaaagccgatgccgtcctgcttggtgcagtcggttctcctcaatacgacaac
ctcgaccgtccgttgcgccctgagcgcggcctgttggcaatccgtaaggatttgaacctg
tttgccaatttgcgtcctgctgttttatatcccgaattagccaacgcctccacgctgaag
cctgaaatcgttgccggtttggatattttgattgtgcgcgaactcaccggcgacatctat
ttcggcgaaccgcgcggcatccgcgttctggaaaacggcgaacgcgaaggctacaacacc
atgaaatacagcgaaagcgaaatccgccgtattgcccatgttgccttccaatccgcccaa
aaacgcagcaaaaaagtctgttccgtaggcaaagccaacgttttggaaaccaccgaattg
tggcgcgaaatctttgaagaaatcggcaaagagtaccctgatgtcgagctttcccatatg
tacgtcgacaacgccgccatgcagctcgtgcgtgcgcccaaacaattcgacgtcattgcc
accggcaacatcttcggcgacattctctccgacgaagcctccatgctgaccggctccatc
ggtatgctgccttccgcctcgctggacgaaaacggcaaaggcctgtacgaaccgtctcac
ggctccgcccccgacatcgccggacaaaacaaagccaacccgctggccaccatcctctcg
ctcgcaatgttgctgcgttacagcctgaacgacgaagcgcgcgcgcaacaagttgaaaac
gccgtccaaaaagtgctgcaacaaggcttgcgtaccagcgacatttacgaagaaggcaca
aaactcgtttcctgctccgaaatgggcgatgcggtactcgccgccttgtaa

DBGET integrated database retrieval system