KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0918Help
Entry
NMBM01240149_0918 CDS       T01930                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00740  Riboflavin metabolism
nmm00790  Folate biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMBM01240149_0918
   00790 Folate biosynthesis
    NMBM01240149_0918
Enzymes [BR:nmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NMBM01240149_0918
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     NMBM01240149_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADY97506
Position
complement(1074575..1075666)
Genome map
AA seq 363 aa AA seqDB search
MSHISPIPEILADIKAGKMVIITDAEDRENEGDLLMAAQFVTPEAINFMIKHARGLVCLP
MDGEMVEKLGLPMMTQKNGAQYGTNFTVSIEAAHGITTGISAADRALTIQTAVSPTAKPE
DIVQPGHIFPLRAQKGGVLVRAGHTEAGVDLAQMNGLIPASVICEIINDDGTMARMPELM
KFAEEHKLKIGTIADLIEYRSRTESLLEDMGNAPVQTPWGEFQQHVYVDKLSGETHLALV
KGTPSADTETLVRVHEPFSVMDFIQANPRHSWSLPKALERIQQAESGVVILLHRTEDGAA
LLDRTLPKGANQAYKWDSKSYGIGAQILAGLNVKKLRVLGQPSSFTGLTGFGLEVVGFEE
AEK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatatttcccccatccccgaaatcctagccgacatcaaagccggcaaaatggtc
atcatcaccgatgccgaagaccgagaaaacgaaggcgacctgctgatggcggcgcaattc
gtcacgcccgaagccatcaacttcatgatcaaacacgcgcgcggcttggtctgcctgccg
atggacggcgaaatggtcgaaaaactcgggctgccgatgatgacccaaaaaaacggcgcg
caatacggcaccaactttactgtctccatcgaagccgcacacggcattaccaccggcatt
tccgccgccgaccgcgccctgactattcaaaccgccgtttccccgaccgctaaacccgaa
gacatcgtccaacccggtcatatctttccgcttcgcgcccaaaaaggcggcgtactcgtc
cgcgccggacacaccgaagccggcgtcgacctggcgcaaatgaacgggctgattcctgcc
tccgttatttgcgaaatcatcaacgacgacggcacgatggcgcgtatgcccgaactgatg
aaattcgccgaagaacacaagctcaaaatcggcacgattgccgacctcatcgaataccgc
agccgtaccgaaagcctgcttgaagacatgggcaatgcgcctgtacaaaccccgtggggc
gagttccaacaacacgtttacgtcgacaaactctccggcgaaacccacctcgccctcgtc
aaaggcacgccctccgccgacaccgaaaccctcgtccgcgtccacgaacccttcagcgtc
atggacttcatccaagctaacccgcgtcattcatggtcgctgcccaaagcactcgagcgc
atccaacaggccgaaagcggcgtagtcatccttctgcaccgcaccgaagacggcgccgcc
ctgctcgaccgcaccctgcccaaaggtgcaaaccaagcctacaaatgggacagcaaaagc
tacggcatcggtgcgcaaatcctcgccggcctcaacgtcaaaaaactgcgcgtcctcggg
cagccctcatctttcaccggcctgaccggcttcggtttggaagtcgtcggctttgaagaa
gcggaaaaataa

DBGET integrated database retrieval system