KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0930Help
Entry
NMBM01240149_0930 CDS       T01930                                 

Gene name
rpe
Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00030  Pentose phosphate pathway
nmm00040  Pentose and glucuronate interconversions
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
nmm01230  Biosynthesis of amino acids
Module
nmm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nmm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMBM01240149_0930 (rpe)
   00040 Pentose and glucuronate interconversions
    NMBM01240149_0930 (rpe)
Enzymes [BR:nmm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     NMBM01240149_0930 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth TMP-TENI PcrB IMPDH
Motif
Other DBs
NCBI-ProteinID: ADY97516
Position
1086319..1087047
Genome map
AA seq 242 aa AA seqDB search
MTAYRIAPSILSADFARLGEEVESVIAAGADLIHFDVMDNHYVPNLTFGPMVCAALKPYA
SVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSLSLIRDMGCQAGLVLNPAT
PVYLLENVLDRLDMVLLMSVNPGFGGQSFIPHTLEKIRRVRAMLDRYEAQSGRHIAIEVD
GGIKTDNIAAVARAGADTFVAGSAIFGKPDYKAVIDAMRAELEKSGRLNLAPMIEIEMPS
EN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctaccgtatcgcacccagtattttgtcggcagactttgcccgcctcggagaa
gaggtggaaagcgtcattgcggcaggtgcagatctgatccattttgacgtgatggacaac
cattatgtgccgaacctgaccttcggccctatggtttgcgcggcgttgaagccttatgca
agcgtgccgatcgatgtgcatctgatggtcgaacccgttgacgacctgattcagtcgttt
gccaaagcaggagcatcgattatcacttttcatcccgaagcgagccgccatatcgaccgc
agcttgagcctgattcgtgatatgggctgtcaggcggggctggtgttgaatccggcaacg
cccgtatatctgttggaaaacgtattggacaggctggatatggttttgctgatgtcggtc
aaccccggattcggcggacaaagcttcatcccgcacacccttgaaaaaatccgccgggtg
cgggcgatgctggatcggtacgaagcacaaagcgggcggcacatcgccatcgaagtggac
ggcggcatcaaaaccgacaatattgccgccgttgcccgagctggtgcggatacctttgtt
gccggttctgcgattttcggcaaaccagactataaggcggtgattgatgcgatgagggcg
gaactggaaaaaagcggcaggctgaaccttgcgccaatgattgaaatagaaatgccgtct
gaaaattag

DBGET integrated database retrieval system