KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0965Help
Entry
NMBM01240149_0965 CDS       T01930                                 

Gene name
guaB
Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00230  Purine metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
Module
nmm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMBM01240149_0965 (guaB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nmm04147]
    NMBM01240149_0965 (guaB)
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     NMBM01240149_0965 (guaB)
Exosome [BR:nmm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NMBM01240149_0965 (guaB)
  Exosomal proteins of breast cancer cells
   NMBM01240149_0965 (guaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth NanE Glu_synthase DHO_dh TMP-TENI G3P_antiterm NAD_binding_7 ThiG
Motif
Other DBs
NCBI-ProteinID: ADY97550
Position
1122404..1123867
Genome map
AA seq 487 aa AA seqDB search
MRIVEKAYTFDDVLLVPAHSTVLPRDVKLQTKLTREITLNLPLLSAAMDTVTEARLAISM
AQEGGIGIIHKNMPPEMQARAVSKVKRHESGVVKDPVTVAPTTLIREVLEMRAQRKRKMS
GLPVVENGKVVGIVTNRDLRFENRVDLPVSAIMTPRERLVTVPEGTSIDEARELMHTHKV
ERVLVLNEKDELKGLITVKDILKTTEFPNANKDSEGRLRVGAAVGTGGDTEERVKALVEA
GVDVIVVDTAHGHSQGVIDRVKWVKETYPHIQVIGGNIATAKAALDLVAAGADAVKVGIG
PGSICTTRIVAGVGVPQLTAIHNVAEALKGTGVPLIADGGIRFSGDIAKALAAGAYSVML
GGMFAGTEEAPGEIELYQGRSYKSYRGMGSLGAMSQGSADRYFQDKTDSTDKYVPEGIEG
RVPYKGPIVNIIHQLTGGLRSSMGYLGCANIAEMHEKAEFVEITSAGMSESHVHDVQITK
EAPNYHR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgtagaaaaagcctatactttcgacgatgttttgttggttcccgcacattcg
accgtgctgccgcgagacgttaaacttcaaaccaagctcacccgcgaaatcacactcaac
ctccccctgctttccgctgcgatggacactgttaccgaggcgcgcctcgccatttcgatg
gcacaggaaggcggcatcggcatcatccataaaaacatgccgcccgaaatgcaggcgcgc
gccgtttccaaagtgaaacgccacgaaagcggcgtggtcaaagaccccgtaaccgttgca
ccgacgacgctcatccgcgaagtcttggaaatgcgtgcgcagcgcaaacgcaaaatgtcc
ggcctgcccgtcgttgaaaacggcaaagtcgtcggcatcgtaaccaaccgcgacctgcgt
tttgaaaaccgcgtcgatttgcccgtttccgccattatgaccccgcgcgaacgtttggtt
accgtccccgaaggcacaagcatagacgaagcgcgcgaactgatgcacacgcacaaagtc
gagcgcgttttggttctgaacgaaaaagacgaactcaaaggtctgattaccgttaaagat
attttaaaaaccaccgagtttcccaacgccaacaaagactccgaaggccgtctgcgcgtc
ggtgcggcagtcggcaccggcggcgataccgaagagcgcgtcaaagccttggtcgaagcc
ggcgtggacgtgattgtcgtcgatactgcccacgggcacagccaaggcgtgattgaccgc
gtgaaatgggtgaaagaaacctatccgcacatccaagtcatcggcggcaacatcgccact
gccaaagccgcattggatttggtcgccgccggtgcggatgccgtcaaagtcggtatcggc
ccgggatcgatttgcaccacccgtatcgtggcaggcgtgggcgtgccgcaactgaccgcc
atccacaacgttgccgaagccctcaaaggcacaggcgttcccctgattgccgacggcggc
atccgcttctccggcgacatcgccaaagccctcgccgcaggcgcgtacagcgtcatgctc
ggcggtatgtttgccggcacggaagaagcgccgggcgaaatcgaactctatcaaggccgc
tcgtacaaatcctatcgcggtatgggttcattgggcgcgatgagccaaggttctgccgac
cgctacttccaagacaaaaccgacagcaccgacaaatacgtccccgaaggcatcgaaggc
cgcgttccttacaaaggcccgattgtgaacatcatccaccagctgaccggcggtctgcgt
tccagtatgggttacttgggttgcgccaatattgccgaaatgcacgaaaaagccgaattt
gtggaaatcacttccgcaggtatgagcgaatcgcacgttcacgacgttcaaatcactaaa
gaagcaccgaactaccaccgctga

DBGET integrated database retrieval system