KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1402Help
Entry
NMBM01240149_1402 CDS       T01930                                 

Gene name
purF
Definition
(GenBank) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00230  Purine metabolism
nmm00250  Alanine, aspartate and glutamate metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
Module
nmm_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMBM01240149_1402 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMBM01240149_1402 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nmm01002]
    NMBM01240149_1402 (purF)
Enzymes [BR:nmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     NMBM01240149_1402 (purF)
Peptidases and inhibitors [BR:nmm01002]
 Cysteine peptidases
  Family C44
   NMBM01240149_1402 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADY97968
Position
1541442..1542986
Genome map
AA seq 514 aa AA seqDB search
MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMHKGKGMVREVFRTRNM
RDLVGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGNLTNTAELYENVCNKHL
RHVNTSSDSEVLLNVFAHELRREVSKNADPHRLNTDNIFNAVAEVHRLVRGAYGVVAMIA
GYGMVAFRDPYGIRPLALGSQTDEAGRKSYAVASESVAFNALAYDLERDIRPGEAVFVGF
DGTIIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSRLDMGVSLAEKIKRELPVDG
IDVVMPIPDTSRPSAMELAVHLKKPYREGLIKNRYIGRTFIMPGQATRKKSVRQKLSPME
TEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIASAAPEVRYPNVYGIDMPTREE
LIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPKIESFDSSCFNGIYQTGDIDDAY
LDRLSAEKSGCGGLKIHPSRMEHSISISDAGDEE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgtattaggtttggtcagtcatgagccggtaaaccagcttctgtacgacggc
ttgcagatgttgcagcacagggggcaggatgcggcgggcattgcaacggccgaaggcggc
accttccatatgcacaaaggcaaaggcatggtgcgcgaagtgttccgcacacgcaatatg
cgcgatttggtcggcaacgccggtatcgcccacgttcgttatcctactgcgggcaacgcg
ggcagcagcgcggaggcgcagcctttctacgtcagctcgcctttcggcattgttttggcg
cataacggcaacctcaccaacactgccgaactttatgaaaacgtgtgtaacaaacacctg
cgccacgtcaacaccagctccgattccgaagtcttgctcaacgtattcgcgcacgaatta
cgccgcgaagtctctaaaaacgccgacccacaccggctcaataccgacaatattttcaac
gccgttgccgaagtccaccgtctggtgcgcggcgcatacggcgtggttgccatgattgcg
ggctacggcatggtcgccttccgcgatccttacggcatccgtccgctggcattgggttcg
caaaccgacgaagcaggcagaaaatcctatgccgtcgcctccgaatccgttgccttcaac
gcgcttgcctacgatttggaacgcgacatccggccgggcgaagcagtatttgtcggcttt
gacggcacaatcatcgcccgccaatgcagcgaccgtgccaaactcagcccctgccttttt
gaatatgtttattttgcccgccccgactctgtgattgacggtgtatcggtttaccaatcg
cgcttggatatgggcgtgtccttggcggaaaaaatcaaacgcgagctgcccgtggacggc
atcgatgtcgtgatgcccatccccgacaccagccgccccagcgcgatggagcttgccgtc
cacctcaaaaagccttaccgcgaaggtttgattaaaaaccgctatatcggccgcaccttt
attatgcccggtcaggcgacgcgcaaaaaatccgtgcgccaaaaactcagcccgatggaa
accgaatttgcaggcaaaagcgtgttgctggtggacgactccatcgtgcgcgggacgacc
agccgcgaaatcgtcgaaatggtacgcgcggcgggcgcgcgcaaagtctatatcgcctcc
gccgcccccgaagtgcgctatcccaacgtatacggcatcgatatgcccacgcgcgaagag
ttgattgccaacgggcgcagcgcggcggaaatcgccgccgaaatcggcgcggacggcatc
gtatttcaagacttgggcgatttggaagccgtcgtcaaagcactcaatccgaaaatcgaa
tccttcgattcgtcctgtttcaacggcatttatcagaccggcgacatcgatgatgcctac
ctcgaccgcctgtctgccgagaaatccggctgcggcggcctgaaaatccacccgagcagg
atggaacacagcatcagcatcagcgatgcgggcgacgaagaataa

DBGET integrated database retrieval system