KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1404Help
Entry
NMBM01240149_1404 CDS       T01930                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
nmm01230  Biosynthesis of amino acids
Module
nmm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM01240149_1404
Enzymes [BR:nmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NMBM01240149_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-ProteinID: ADY97970
Position
1543636..1544262
Genome map
AA seq 208 aa AA seqDB search
MRKIRTKICGITTPEDAAAAAAAGADAVGLVFFQGSSRVVDIARAKKITAALPPFVSVVA
LFVNESAQNIRRILAEVPIHIIQFHGDEDDTFCRQFHRPYIKAIRVQTTSDIRNAADRFP
DAQALLFDAYHPSEYGGTGHRFDWTLLAEYSGKPWVLAGGLTPENVGEAVRITGAEAVDV
SGGVEASKGKKDPAKVAAFIATTNRLSR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaatccgcaccaaaatctgcggcatcaccacaccggaagacgcagcggccgcc
gcagcggcaggtgcggatgccgtcgggctggtctttttccaaggcagcagccgggtcgtc
gatattgcccgcgcaaaaaaaatcaccgccgcactgccgccgtttgtcagcgttgtcgcc
cttttcgtcaacgaaagcgcgcaaaacatccgccgcatccttgccgaagtgccgatacac
atcatccaattccacggcgacgaagacgacacattctgccgtcagttccaccgcccctat
atcaaggccattcgtgttcagacgacatcagacatccgaaacgccgccgaccgcttcccc
gacgctcaggcactgcttttcgatgcctaccatccttcggaatacggcggcaccggacac
cgcttcgactggacgctgctggcggaatattcgggcaaaccgtgggtacttgccggcggg
ctgacccctgaaaacgtcggcgaagccgtccgcatcaccggagcggaagcggtcgatgta
tccggcggcgtggaagcgtctaaaggcaaaaaagacccagccaaagtcgccgcctttatc
gcaaccaccaaccgcctatcccgttaa

DBGET integrated database retrieval system