KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1466Help
Entry
NMBM01240149_1466 CDS       T01930                                 

Gene name
hisH
Definition
(GenBank) imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00340  Histidine metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMBM01240149_1466 (hisH)
Enzymes [BR:nmm01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     NMBM01240149_1466 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 DJ-1_PfpI NAR2 SNO Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADY98030
Position
1598715..1599353
Genome map
AA seq 212 aa AA seqDB search
MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTEIFLSGDPERVSRADKVIFPGQGAMPDCM
AALKRDGLDEAVKDALKNKPFFGICVGAQLLFNHSEEGNTDGLGWFGGKVRRFERDLRDR
QGCRLKVPHMGWNTVRQTQNHPLFKDIPQNTRFYFVHSYYFDPENPETILGESDYPSPFA
CIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgccattatcgattacggtatgggcaacctgcattccgtattgaaatccgtc
cggacggcggggcagcttgccggaaaaaataccgaaatctttttaagcggcgaccccgaa
cgcgtgtcccgcgccgacaaagtcatttttcccggtcagggcgcgatgcccgactgtatg
gcggcattaaaacgagacggtttggacgaggcagtcaaagatgccttaaaaaacaaaccc
tttttcggaatctgcgtcggcgcgcaacttttattcaaccacagcgaagaaggaaacacc
gacggcttgggctggttcggcggcaaagtcagacgctttgagcgcgacctccgcgaccgg
cagggatgccgtctgaaagtcccgcatatgggctggaacaccgtgcgccaaacccaaaac
cacccgctgtttaaagatattccccaaaacacgcgtttttacttcgtccacagctactat
ttcgaccccgaaaatcccgaaaccatattgggcgaaagcgactacccgtccccgtttgcc
tgcatcgtcggcaaagacaacgtattcgccacgcaatttcacaccgaaaaaagccacgat
gccgggctgacgatgttgaaaaactttttaaactggtaa

KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1468Help
Entry
NMBM01240149_1468 CDS       T01930                                 

Definition
(GenBank) imidazoleglycerol phosphate synthase, cyclase subunit
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00340  Histidine metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMBM01240149_1468
Enzymes [BR:nmm01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     NMBM01240149_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus NMO ThiG G3P_antiterm DHO_dh IMPDH FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADY98032
Position
1600136..1600903
Genome map
AA seq 255 aa AA seqDB search
MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNR
DTILHIIEEVAGQVFIPLTVGGGVRTVADIRRLLNAGADKVSINTAAVTRPDLIDEAAGF
FGSQAIVAAVDAKAVNPGNTRWEIFTHGGRNPTGLDAVEWAIEMQKRGAGEILLTGMDRD
GTKQGFNLPLTRAVAEAVDIPVIASGGVGNVRHLIEGITEGKADAVLAAGVFHFGEIAIR
EAKRAMREAGIEVRL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggcactggcaaaacgcatcatcccctgtctcgacgtaaaagacgggcgcgtcgtcaaa
ggcgtgaacttcatcggtttgcgcgacgcgggcgaccccgtcgaagccgccaaacgctac
aacggcgaaggcgcggacgaattgaccttcctcgacatcaccgcctcatccgacaaccgc
gacaccatcctgcacatcatcgaagaagttgccggacaagtcttcatccccctgaccgtc
ggcggcggcgtacgcaccgttgccgacatccgccgcctgctcaatgccggcgcggacaaa
gtcagcatcaacaccgccgccgttacccgtcccgacctgattgacgaagccgccggattt
ttcggttcgcaagccatcgtcgccgccgtcgatgccaaagccgtcaaccccggaaacaca
cgctgggaaatctttacccacggcgggcgcaatccgaccggtttggatgcggtggaatgg
gcgatcgaaatgcaaaaacgcggcgcgggcgaaatcctgcttaccggtatggacagggac
ggtacgaaacagggtttcaacctgccgctgacccgcgccgttgccgaagccgtcgacatc
cccgtcatcgcctccggcggggtcggcaatgtccggcacctgattgaaggcataaccgaa
ggcaaagccgatgccgtacttgccgccggcgttttccatttcggggaaatcgccatccgc
gaagccaaacgcgctatgcgcgaagccggcatcgaagtgcgcctctga

DBGET integrated database retrieval system