KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1528Help
Entry
NMBM01240149_1528 CDS       T01930                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00260  Glycine, serine and threonine metabolism
nmm00630  Glyoxylate and dicarboxylate metabolism
nmm00670  One carbon pool by folate
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMBM01240149_1528 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM01240149_1528 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMBM01240149_1528 (gcvT)
Enzymes [BR:nmm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NMBM01240149_1528 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD SoxG
Motif
Other DBs
NCBI-ProteinID: ADY98091
Position
complement(1665215..1666315)
Genome map
AA seq 366 aa AA seqDB search
MITLKTTPFHQAHQDAGAKPVDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSHMLVTDVA
GANAKAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVYRTNEAETQYRIVSNGA
TREKDTAQFHKVGQEFGVAFNPRYDLGMLAVQGPKAIEKLLTVKPEWADVIHGLKPFQGA
DLGNDWFVARTGYTGEDGVEVILPGTEAVAFFKALQAAGVQPCGLGARDTLRMEAGMNLY
GNDMDDDTSPLEAGMGWTVDLKDESRDFVGKAALLALKEKGVAVKQVGLLLGKGGILRAH
MEVLTDKGKGETTSGVFSPSLKQSIAIARVPKDFDGDTAKVLMRGKEVDVRVLKLPFVRN
GQKQFD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgattactctgaaaaccaccccatttcatcaagcccatcaagatgcaggcgcgaagccg
gtagattttgccggctgggagctgcccatccattatggttcgcaaatcgccgaacacgaa
gccgtgcgcaccgacgccggtatgtttgacgtatcccatatgcttgttaccgacgtagca
ggcgcaaatgccaaagcctttttccgcaaattgattgccaacgatgtcgccaagctcgct
tttgtcggcaaagccctttattccgctttgctcaacgacaacggcggcgtgattgacgac
ttaatcgtttaccgcaccaacgaagccgaaacccaataccgcatcgtgtccaacggagcg
actcgcgaaaaagacacggcgcaattccacaaagtcggacaagagttcggcgttgccttt
aatccgcgctacgacctcggcatgctcgccgtacaaggccctaaagccatcgaaaaactc
ctgaccgtcaaacctgaatgggcggatgtgattcacggcctcaaaccgttccaaggtgca
gacttgggcaacgattggtttgtcgcccgcaccggctataccggcgaagacggcgtcgaa
gtgattctgccgggcactgaagccgtcgcattcttcaaagccctgcaagcagcaggcgta
caaccttgcggtctcggcgcgcgcgacaccctgcgcatggaagccggcatgaacctctac
ggcaacgatatggacgacgataccagcccgctcgaagcaggcatgggttggaccgttgat
ttgaaagacgaaagccgcgattttgtcggcaaagctgccttgttggcattgaaagaaaaa
ggcgttgccgtcaaacaggtcggtttgctgctcggcaaaggcggcatcctgcgcgcgcat
atggaagtgttgaccgacaaaggcaaaggcgaaaccaccagcggcgtattctcgcccagc
ctgaaacaatccatcgccatcgcccgcgtaccgaaagactttgacggcgataccgctaaa
gtgctgatgcgtggcaaggaagtggacgtgcgcgtattgaagttgccgttcgtgcgtaac
ggtcaaaaacagtttgattaa

DBGET integrated database retrieval system