KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1557Help
Entry
NMBM01240149_1557 CDS       T01930                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00010  Glycolysis / Gluconeogenesis
nmm00071  Fatty acid degradation
nmm00350  Tyrosine metabolism
nmm00625  Chloroalkane and chloroalkene degradation
nmm00626  Naphthalene degradation
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_1557
  Lipid metabolism
   00071 Fatty acid degradation
    NMBM01240149_1557
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBM01240149_1557
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBM01240149_1557
   00626 Naphthalene degradation
    NMBM01240149_1557
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBM01240149_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding TrkA_N Methyltransf_25 DUF2237 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADY98119
Position
1697487..1698527
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVNADYAVKVPDGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDDKLAFAKESGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaacgcgag
gttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtcaatgcggattatgcggtcaaagtccccgacggtctcgaccccgcc
caagcgtccagcatcacttgtgccggcgtgaccacttataaagccattaaagtttccagt
gttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgacgacaaa
ctggcgtttgccaaagaaagcggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaacaggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccatc
ggactgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggtcgtatggtaatcgatatgaaaaaagaatgc
ggctgcggccaccaccactga

DBGET integrated database retrieval system