KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_2000Help
Entry
NMBM01240149_2000 CDS       T01930                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00020  Citrate cycle (TCA cycle)
nmm00620  Pyruvate metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
Module
nmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240149_2000 (mqo)
   00620 Pyruvate metabolism
    NMBM01240149_2000 (mqo)
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NMBM01240149_2000 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 MCRA
Motif
Other DBs
NCBI-ProteinID: ADY98529
Position
complement(2165166..2166632)
Genome map
AA seq 488 aa AA seqDB search
MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWNNAGTGHSALC
ELNYAPLGANGIIDPARALNIAEQFHVSRQFWATLVAEGKLEDNSFINAVPHMSLVMNED
HCSYLQKRYDAFKTQKLFENMEFSTDRNKISDWAPLMMRGRDENQPVAANYSAEGTDVDF
GRLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGA
GGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHL
DTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDNLYPMLCAGWANMPLTKYLLG
ELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKDSEKGGVLQFGTEIVAHADGS
LAALLGASPGASTAVPLMIRLMHQCFPERAPSWEDRLKELVPGYGIKLNENPERADEIIA
YTAKVLDI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgacagacgttgtcttggtgggcggcggcattatgagcgcgactttgggc
gttttgctcaaagaactcgaaccgtcttgggaaatcaccctgattgaacgcttggaagat
gtggcgttggaatcgtcaaacgcgtggaacaacgccggcacggggcattccgcgctgtgc
gaattgaactatgcgccgttgggtgcaaatgggattatcgatccggcgcgcgccctcaat
attgccgaacagtttcatgtcagccgccagttttgggcgacgctggtcgcggaaggcaag
ttggaagacaattccttcatcaatgccgtgccgcatatgtctttggtgatgaatgaagac
cattgttcttatcttcaaaaacgttatgacgcgtttaaaacccaaaaactttttgaaaat
atggaattttccaccgatcggaacaaaatttccgattgggctccgctgatgatgcgcggc
cgggacgaaaaccaacccgtcgccgccaactactccgccgaaggtacggatgtcgatttc
ggacggctgacgcgccaaatggtgaaatatttgcagggcaagggcgtaaaaaccgagttc
aaccgccacgtcgaagacatcaaacgcgaatccgacggcgcgtgggtgctcaaaaccgcc
gatacccgcaaccccgacgggcagctcaccctccgtacccgcttcctcttcctcggcgcg
ggcggcggcgcgctgaccctgctgcaaaaatccggcatccccgaaggcaaaggctacggc
ggcttccccgtgtccggcctgttcttccgcaacagcaaccccgaaaccgccgaacaacac
aacgccaaagtgtacgggcaggcttccgtcggcgcgccgccgatgtccgtcccgcacctc
gacacacgcaacgtggacggcaaacgccaccttatgttcggcccttacgcaggcttccgt
tccaacttcctcaagcaaggctcgcttatggatttgccgctgtccatccatatggacaac
ctctatcctatgctgtgcgccggctgggcgaatatgccgctgaccaaatacctgctgggc
gaattgcgtaaaaccaaagaagaacgcttcgcctccctgctggaatactaccccgaggca
aaccccgacgactgggaactcatcaccgcagggcaacgcgtccaaatcattaaaaaagac
tccgaaaaaggcggcgtgctccagtttggtacggagattgtcgcccacgccgacggctca
ctcgccgcattgctgggcgcgtcgccgggcgcatcgaccgctgtgccgctgatgatccgg
ctgatgcaccaatgcttccccgagcgcgccccgtcttgggaagaccgtctgaaagagctg
gtaccgggttacggcatcaagttgaacgaaaaccctgaaagggcggatgaaattatcgcc
tataccgcgaaagtattggatatttaa

DBGET integrated database retrieval system