KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0107Help
Entry
NMCC_0107         CDS       T00633                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00670  One carbon pool by folate
nmn01100  Metabolic pathways
nmn01120  Microbial metabolism in diverse environments
nmn01200  Carbon metabolism
Module
nmn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMCC_0107 (folD)
Enzymes [BR:nmn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     NMCC_0107 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     NMCC_0107 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABX72329
UniProt: A9M068
Position
complement(109313..110071)
Genome map
AA seq 252 aa AA seqDB search
MPCLAVVLVGGDPASAVYVRNKKTACQKCGIKSLSYELPESTSQEELLALVDRLNADSEV
DGILVQLPLPKHLDSQAVLERISPDKDVDGFHPYNVGRLAVKMPLMRPCTPKGVMTLLEA
YGIDPKGKKAVVVGASNIVGRPQALELLLARATVTVCHSATENLADEVAGADILVVGVGI
PNFVKGEWIKPGAVVIDVGINRLDDGSLCGDVEFETAKERAAMITPVPGGVGPMTIATLM
ENTLHAASLHDA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcctggccgtggttttggtcggaggcgaccctgccagcgcggtttatgtccgc
aacaagaaaactgcctgccaaaaatgcggcatcaaatcactgtcttacgagctgcccgaa
tcaacatcgcaggaagaactgctggcactggtcgaccgcctgaatgccgattccgaagtg
gacggtattctggttcagctaccgctgccgaagcacctcgacagccaggcggttttggaa
cgtatttcgccggataaggacgtggacggcttccatccttacaatgtcggcaggctggcg
gtcaaaatgccgctgatgcgcccgtgtacgcccaagggcgtgatgacgcttttggaagct
tacggcattgatccgaaggggaaaaaagcggtcgtggtcggcgcgtcgaatatcgtcggc
cgcccgcaggctttggaactgctgctggcgcgcgcaacggtaacggtctgccacagcgca
accgaaaatctggcagacgaggttgccggagccgatattttggtggtcggcgtgggcatt
ccgaactttgtcaaaggcgaatggatcaaacccggcgcggtcgttatcgatgtgggcatc
aaccgtttggacgacggcagcctgtgcggcgacgtggaatttgaaacggcaaaagaacgg
gcggcgatgattacgcccgttcccggcggcgtgggtccgatgacgattgccacattgatg
gaaaacaccctgcacgcggcttcactgcacgatgcttga

DBGET integrated database retrieval system