KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0177Help
Entry
NMCC_0177         CDS       T00633                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00783  23S rRNA (pseudouridine1915-N3)-methyltransferase [EC:2.1.1.177]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Brite
KEGG Orthology (KO) [BR:nmn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nmn03009]
    NMCC_0177
Enzymes [BR:nmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.177  23S rRNA (pseudouridine1915-N3)-methyltransferase
     NMCC_0177
Ribosome biogenesis [BR:nmn03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    NMCC_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOUT_MTase
Motif
Other DBs
NCBI-ProteinID: ABX72393
UniProt: A9M0D2
Position
179331..179768
Genome map
AA seq 145 aa AA seqDB search
MPRWVDEAVAEYAKRFGRDVAYALKEIKPEKRGAGVNAAQGMAAEEKRILEAIPQGAFLV
VLDERGKAPTSVELAEHLKTWQQNGEHVCFVIGGADGMTDRLKQQARIMMRLSSLTLPHG
MVRVLLTEQLYRAASILHNHPYHRE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctgggttgatgaggccgtcgccgaatacgccaaacgcttcggacgcgacgtc
gcctacgcactcaaagaaatcaaacccgaaaaacgcggcgcgggcgtgaatgccgcccaa
ggtatggcggcggaagaaaaacgcatcctcgaagccataccgcaaggcgcgttcctcgtc
gtccttgacgaacgcggcaaagcaccgacctccgtcgagctggcggaacacctcaaaact
tggcagcaaaacggcgaacacgtctgcttcgtcatcggcggcgcggacggaatgaccgac
cgcctcaaacaacaagcccgcataatgatgcgcctgtccagcctgaccctgccgcacggg
atggtgcgcgtccttctgaccgagcagctctaccgcgccgcctccatcctgcacaaccat
ccctatcatcgggaataa

DBGET integrated database retrieval system