KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0765Help
Entry
NMCC_0765         CDS       T00633                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00860  Porphyrin and chlorophyll metabolism
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01120  Microbial metabolism in diverse environments
Module
nmn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMCC_0765 (hemB)
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NMCC_0765 (hemB)
Exosome [BR:nmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMCC_0765 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABX72958
UniProt: A9M3N3
Position
771322..772161
Genome map
AA seq 279 aa AA seqDB search
MPGVKRQSLDRLLFTAEEAVKLGIPMLALFPVVTANKTERAQEAYNPEGLVPSTVRALRE
RFPELGIMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDM
MDGRIGAIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPA
NTDEALHEVALDIQEGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAVA
NGWLDGDKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtgtgaagcgtcaaagtttggacaggctgctgtttacggcggaagaggcggta
aagctcggtattccgatgttggcactgttccccgtggttacggcaaacaaaaccgagcgt
gcgcaggaggcgtacaatcccgaaggactcgtgccgtcaactgtccgcgccttgcgcgag
aggtttcccgaactgggcattatgacggatgtcgcgctcgatccttatacggttcacggt
caggacgggctgacggacgaaaacggttatgtgatgaacgatgaaaccgtagaggttttg
gtcaagcaggctttgtgccacgctgaagcgggcgcgcaggtggttgccccttccgatatg
atggacgggcgtatcggtgcgattcgcgaggcgttggaggatgccgggcatatccatacg
cggattatggcgtattccgccaaatatgcttctgcattttacggccctttccgtgatgcg
gtaggcagttcgggcaatttgggcaaggcagataaaaagacctatcagatggatcccgca
aataccgatgaggcgctgcatgaggtggcgttggacattcaggaaggtgcggatatggtg
atggtcaagcccggtttgccgtatttggacgttgtccgacgcgtgaaggacgagttcggt
gtgccgacttatgcctatcaggtttcgggcgaatatgcgatgctgcaggcggcggttgcc
aacggctggctggacggcgataaggtggtcttggaaagcctgctggcattcaaacgtgcg
ggcgcggacgggattttgacctattatgccattgaggcggcaaagatgctgaagcgttga

DBGET integrated database retrieval system