KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0899Help
Entry
NMCC_0899         CDS       T00633                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00020  Citrate cycle (TCA cycle)
nmn00310  Lysine degradation
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01120  Microbial metabolism in diverse environments
nmn01130  Biosynthesis of antibiotics
nmn01200  Carbon metabolism
Module
nmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMCC_0899 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMCC_0899 (sucB)
Enzymes [BR:nmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMCC_0899 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABX73081
UniProt: A9M4F5
Position
900947..902158
Genome map
AA seq 403 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMP
AAAKLAAESGVDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMS
RLRARVAERLLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAA
VAALKKYPVVNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDY
AKKAKDGKIAIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQV
VVRPMMYLALSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgctgctactgccgctgctgaagcacctgccgccgct
cctgccgaagctgccccggccgccgctcctgctgctgcacaaaacaacgccgctatgcct
gccgccgccaaactggctgcagagagcggtgttgacgtgaacgcattgcaaggttccggc
cgtgacggtcgcgtattgaaagaagacgtacaaaatgccgctgccaaacctgccgcagcc
gctgctcctgctgttgcacttcctgccggcgcacgtcctgaagaacgcgtaccaatgagc
cgcctgcgtgcccgtgttgcagaacgcctcttggcttctcaacaagaaaacgccattctg
actacattcaacgaagtcaacatgaaaccaatcatggacttgcgtgcgaagtacaaagaa
aaattcgagaaagaacacggcgtgaaactgggctttatgtccttcttcgttaaagccgct
gttgccgccctgaaaaaatacccggttgtgaatgcttctgttgacggcaaagacatcgtg
taccacggctacttcgacatcggtatcgcaattggcagcccacgcggtttggttgtgcca
atcctgcgcgatgccgaccaaatgagcattgccgacatcgaacaagcaattgttgattac
gcgaaaaaagccaaagacggcaaaatcgctatcgaagatctgaccggcggtacattcagt
attaccaacggcggtactttcggttctatgatgtccaccccgatcatcaatccgcctcaa
tctgcgattttgggtatgcacgccactaaagagcgcgctgtggttgaaaacggccaagtt
gttgtccgtccaatgatgtatctggctctgtcttacgaccaccgtatcattgacggccgc
gaagctgtattgaccttggtagccattaaagacgcgttggaagacccagcccgcctgttg
ttggatctgtaa

DBGET integrated database retrieval system