KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0526Help
Entry
NMBB_0526         CDS       T01932                                 

Definition
(GenBank) 8-amino-7-oxonoanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00780  Biotin metabolism
nmp01100  Metabolic pathways
Module
nmp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nmp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMBB_0526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmp01007]
    NMBB_0526
Enzymes [BR:nmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     NMBB_0526
Amino acid related enzymes [BR:nmp01007]
 Aminotransferase (transaminase)
  Class II
   NMBB_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADO30994
UniProt: E3D1Q0
Position
496451..497593
Genome map
AA seq 380 aa AA seqDB search
MKVFKQQLEQLGAQNQYRSIPDLIHQGRYITRENCKMLNMSSNDYLGLASDENLRRSFLQ
QYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTT
KSLILADKFVHASMIDGIRLSRCAFFRYRHNDYEHLKNLLEKNVGKFDRTFIVTESVFSM
DGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKA
LASVGAYAVCNQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLS
AFLRREVAHRTQIMPSQTCIVPYILGGNEAALAKAEYLQRQGYYCLPIRPPTVPKNTSRI
RLSLTADMTTDEVRQFAACL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttaaacaacagcttgaacaactcggcgcgcaaaaccaatatcgttcgatt
ccggatttgattcatcaagggcggtatattacgcgggaaaactgcaaaatgctgaatatg
tcgtctaatgattatttgggtttggcatcagatgaaaacttgcgccggtcttttttgcag
caatacggcggtaattttccctcttttaccagttcttcatcgcgtttattaacgggcaac
tttcctatttataccgatttggaagagcttgtcgcacaacgtttccaacgggaaagcgcg
ttattgttcaacagcggctatcacgccaatctcggtattttgcctgctttgacgacgacg
aaaagtttgattttggcagataaatttgttcacgccagtatgattgacggcatccgtttg
agccggtgtgcgtttttccgttatcgtcataatgattatgaacatttgaaaaatctgctt
gaaaaaaacgtcggaaaatttgaccgcacttttatcgttaccgaatctgttttcagtatg
gacggcgatgtggcggatttgaaacagcttgtccaattaaaaaaacagtttcccaatact
tatctttatgtggatgaagcccacgcaatcggtgtttatgggcaaaacggattggggatt
gccgaacgggataatttgattgccgagattgatttactggtcggcactttcggcaaagcc
ttagcctcggtgggggcgtatgccgtctgcaaccaagtattgaaagaatgtttgattaat
caaatgcgcccattgattttttcaaccgcattgccgccgtttaatgtggcttggacttat
tttatttttgaacgattgccgcaattctcaaaagaaagaagccatcttgagcagttaagt
gcatttttacggcgggaagtggcgcatcggacgcaaataatgccgagccaaacctgtatc
gtcccctatattttaggcgggaatgaagccgcccttgccaaagcggaatatctgcaaagg
cagggttattattgcctgcccatcagaccgccgacagtacccaaaaacacatccagaatc
cgcctgtctttaacggcagatatgacaacggatgaagtgcggcagtttgcggcgtgcctg
taa

DBGET integrated database retrieval system