KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1061Help
Entry
NMBB_1061         CDS       T01932                                 

Definition
(GenBank) SurE protein
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00230  Purine metabolism
nmp00240  Pyrimidine metabolism
nmp00760  Nicotinate and nicotinamide metabolism
nmp01100  Metabolic pathways
nmp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMBB_1061
   00240 Pyrimidine metabolism
    NMBB_1061
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMBB_1061
Enzymes [BR:nmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NMBB_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ADO31437
UniProt: E3D480
Position
955525..956271
Genome map
AA seq 248 aa AA seqDB search
MNVLISNDDGYLSEGIAVLARVTAEFANVRVVAPERDRSGVSNSLTLERPLQLKQAQNGF
YYVNGTPTDCIHIGQSVFSDFQADFVFSGINRGANMGDDTLYSGTVAAATEAYLMGIPAV
AFSLNDASGRYWATAEQALWTLLAHFFKTPPQSPILWNINIPAVAPEDVRGIKIARLGRR
HHGQNVIPARNPRGEQIYWIGPVGEVSDREEGTDFGECGAGFITVTPLQIDLTAYPDMAE
TAAFWHAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttgatttccaacgacgacggctacctctccgaaggcatcgccgttttggcg
cgcgttacggcggaatttgccaacgtcagggtggtcgcgcccgaacgcgacaggagcggg
gtcagcaattcgctgacgctggaacgccctttgcagttgaaacaggcgcaaaacgggttc
tactatgtcaacggcacgccgaccgactgcatccacatcgggcagtctgtattttcggat
tttcaggccgattttgtcttttcgggcatcaaccggggcgcgaatatgggggacgacacg
ctttattcggggacggttgcggcggcaaccgaagcctaccttatgggcatacccgccgtg
gcgttttccttaaacgacgcttccggacgctattgggcgaccgcagaacaggcactgtgg
acattgttggcgcattttttcaaaacccccccgcagtcccctattttatggaacatcaat
atccccgccgtcgcgccggaagatgtgcggggcattaaaatcgcccgtttgggcaggaga
caccacggtcagaacgtcatccccgcgcgcaatccgcgcggcgaacagatttattggata
gggccggtcggcgaagtttccgatcgggaagagggaacggatttcggtgaatgcggcgca
ggtttcattaccgtaacgccgctgcaaatcgacctgaccgcctatccggacatggcggaa
acagcggcgttctggcatgcggactga

DBGET integrated database retrieval system