KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1759Help
Entry
NMBB_1759         CDS       T01932                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00300  Lysine biosynthesis
nmp01100  Metabolic pathways
nmp01120  Microbial metabolism in diverse environments
nmp01230  Biosynthesis of amino acids
Module
nmp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMBB_1759
Enzymes [BR:nmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NMBB_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADO31994
UniProt: E3D6T7
Structure
PDB: 

Position
complement(1562901..1564046)
Genome map
AA seq 381 aa AA seqDB search
MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA
PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEH
PDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRR
GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNING
GTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTHAG
KLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINENVRLND
IPKLSAVYEGILARLLAGNAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaactcaatccctagagcttgccaaagagctgatttcccgaccatccgttacc
cctgacgacagggattgccaaaaactccttgccgaacgcctgcacaaaatcggttttgcg
gctgaagaactccatttcggcgacaccaaaaacatctggttgcgacgcggcacgaaagct
cccgtcgtctgttttgcagggcataccgacgttgtaccgacaggtcctgtcgaaaaatgg
gattcgcccccgttcgaaccggccgagcgcgacggaagattatacgggcgcggcgcggca
gacatgaaaaccagcatcgcctgcttcgttaccgcctgtgaacgcttcgttgccgaacat
cccgaccaccaaggcagcattgcgcttctgattacttccgacgaagagggcgacgcgttg
gacggcacgaccaaagtcgtcgatgtattgaaagcgcgcgacgagcttatcgactactgc
atcgtcggcgaaccgacagccgtggacaaattgggcgatatgattaaaaacggccggcgc
ggctcgctgtcgggcaacctgaccgtcaaaggcaagcaaggccatattgcctatccgcat
ttggcaatcaatcccgtgcatacttttgccccggccttgttagagctgacgcaggaagtc
tgggacgaaggcaacaaatacttcccgccgaccagctttcaaatttccaatatcaacggc
ggtacaggcgcgaccaatgtcattccgggcgagctgagcgtcaaattcaatttccgcttc
tccaccgagtccaccgaagcagggctgaaacaacgcgtccacgccattttggacaaacac
ggtgtgcaatacgatttgcagtggtcgtgttcggggcagcccttcctgacccacgcgggc
aaactgaccgacgtggcacgcgccgccattgccgaaatctgcggcgtagagaccgaattg
tccaccaccggcggcacttcggacggacgcttcatcaaagccattgcaaaagaactcatc
gaattaggcccgtccaatgcgaccatccaccaaatcaacgaaaacgtgcggctaaacgac
attccgaagctgtctgcggtgtatgaggggatattggcgcggttgttggctggaaatgcc
gtctga

DBGET integrated database retrieval system