KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1945Help
Entry
NMBB_1945         CDS       T01932                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00790  Folate biosynthesis
nmp01100  Metabolic pathways
Module
nmp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMBB_1945 (folP)
Enzymes [BR:nmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NMBB_1945 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADO32133
UniProt: E3D1V7
Position
complement(1733516..1734367)
Genome map
AA seq 283 aa AA seqDB search
MARHVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRPCADYVSPEEEWARVEPVLAEVAGWGVPVSLDTRRTVIMEKALALGGIDIIND
VAALTDEGAVELLARQTDTGICLMHMRGLPENMQINPKYQDVVGEVARYLKARAAECIAA
GIAPQRITLDPGFGFGKTLQHNITLMRHLPELMAETGFPLLIGVSRKRMVGELTGETDAA
ARVHGSVAAAVAAVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggtatcgtgaatctcacgcccgattctttttccgacggcggcgcgtattctcaaaac
gcccaaaccgctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggcgaatcgacgcggccgtgcgcggattatgtttcgcctgaagaagaatgggcg
cgggttgagcctgtattggcagaagtggcggggtggggcgttcccgtcagtttggacaca
cgccgcacggtgattatggaaaaagcgttggcactcggtggcatcgatattattaacgat
gtggcggcgttgaccgacgaaggtgcggtcgaattgctggcgcgccagacggacacgggc
atttgcctgatgcacatgcggggtttgcctgaaaacatgcagattaatccgaaatatcag
gatgttgtcggtgaagtggcgcggtatttgaaagcgcgggcggcggaatgcatcgcggca
ggcatcgcaccgcaacgcatcacgctcgatccgggtttcggcttcggcaaaaccctgcaa
cacaatatcacgctgatgaggcatttgcccgaattgatggcggaaacaggctttccgctg
ctgatcggcgtatcgcgcaaacgcatggtaggcgaactgacgggcgaaaccgacgcggcg
gcgcgcgtacacggcagcgtggcggcggctgtggcggctgtggcgcgcggcgcgcaaatt
gtgcgggtgcatgacgtgaaggcgacggcggacgcgttgaaggtgtgggaagcgttgggc
atcaatctgtaa

DBGET integrated database retrieval system