KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0026Help
Entry
NMBM04240196_0026 CDS       T01948                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00450  Selenocompound metabolism
nmq00970  Aminoacyl-tRNA biosynthesis
nmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMBM04240196_0026 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMBM04240196_0026 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmq01007]
    NMBM04240196_0026 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmq03016]
    NMBM04240196_0026 (metG)
Enzymes [BR:nmq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NMBM04240196_0026 (metG)
Amino acid related enzymes [BR:nmq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NMBM04240196_0026 (metG)
Transfer RNA biogenesis [BR:nmq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMBM04240196_0026 (metG)
 Prokaryotic type
   Other AARSs
    NMBM04240196_0026 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e DALR_1
Motif
Other DBs
NCBI-ProteinID: ADZ00583
Position
complement(23346..25400)
Genome map
AA seq 684 aa AA seqDB search
MTRKILVTSALPYANGSIHLGHMVEHIQTDVWVRFQKLRGNECHYCCADDTHGTPVMLAA
QKQGIAPEDMIAKVREEHLADFTGFFIGYDNYYSTHSPENKQFSQDIYRALKANGKIESR
VIEQLFDPEKQMFLPDRFVKGECPKCHAQDQYGDNCEVCGTTYSPTELINPYSAVSGAKP
ELRESEHFFFKLGECADFLKAWTSGNNPHDGKPHLQAEALNKMKEWLGEGEETTLSDWDI
SRDAPYFGFEIPDAPGKYFYVWLDAPVGYMASFKNLCDRIGVDFDEYFKAGSQTEMYHFI
GKDILYFHALFWPAMLHFSGHRAPTGVYAHGFLTVDGQKMSKSRGTFITAKSYLEQGLNP
EWMRYYIAAKLNSKIEDIDLNLQDFISRVNSDLVGKYVNIAARASGFIAKRFEGRLKDVA
DSALLAKLTAQSEAIAECYESREYAKALRDIMALADIVNEYVDANKPWELAKQEGQDARL
HEVCSELINAFTMLTAYLAPVLPQTAANAARFLNLDAITWANTRVTLGEHAINKYEHLMQ
RVEQKQVDDLIEANKQSIQTTPAPVEDSKYEKVAEQAGFDDFMKIDMRVAKVLNCEAVEG
STKLLKFDLDFGFEKRIIFSGIAAFYPNPAELNGRMVIAVANFAPRKMAKFGVSEGMILS
AATADGKLKLLDVDAGAQPGDKVG
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaaaatcctcgttacctccgccctgccctatgccaacggcagcatccacctc
ggccacatggtcgaacacatccaaaccgacgtttgggtgcgctttcaaaaactgcgcggc
aacgaatgccactactgctgcgccgacgacacccacggcacgcccgtgatgcttgccgcg
caaaaacaaggcatcgcgcccgaagacatgattgccaaagtgcgcgaagagcacctcgcc
gactttactggctttttcatcggttacgacaattattacagcacccattcccctgaaaac
aaacagttttcccaagacatttaccgcgcgctgaaagccaacggcaagattgagagccgc
gtcatcgagcagcttttcgaccccgaaaaacaaatgttcctgcccgaccgcttcgttaaa
ggcgaatgcccgaaatgccacgcccaagaccaatacggcgacaactgcgaagtctgcggc
acgacctattccccgaccgaactgattaacccgtattccgccgtttccggcgcgaaaccc
gaattgcgcgaatccgaacacttcttcttcaaactgggagaatgcgccgacttcctcaaa
gcatggacttccggcaacaacccgcacgacggcaagccccatctgcaagccgaagccctc
aacaaaatgaaagaatggctgggcgaaggtgaagaaaccaccctgtccgactgggatatt
tcccgcgacgcgccgtatttcggttttgaaatccccgacgcgccgggcaaatacttctac
gtctggctggacgcgcccgtcggctacatggcgtcgtttaaaaacctgtgcgaccgcatc
ggcgtcgatttcgacgaatacttcaaagccggcagccaaaccgagatgtaccacttcatc
ggcaaagacatcctctatttccacgccctgttctggcccgctatgctgcatttctccggc
caccgcgccccgaccggcgtgtacgcacacggcttcctaaccgtcgacggacaaaaaatg
tccaaatcgcgcggcacgtttattaccgccaaatcctatctggaacaaggtttaaacccc
gagtggatgcgctactacatcgccgccaaactcaacagcaaaatcgaagacatcgatttg
aacctgcaagactttatttcgcgcgtaaacagcgacctcgtcggcaaatacgtcaacatc
gccgcccgcgcctcaggtttcatcgccaaacgctttgaaggccgtctgaaagacgtcgcc
gacagcgcattattggcaaaactgaccgcacaaagcgaagccattgccgaatgctacgaa
agccgcgaatacgccaaagccctgcgcgacatcatggccttggcggacattgtcaacgaa
tacgttgatgccaacaaaccttgggaactcgccaaacaagaaggccaagacgcacgcctg
cacgaagtatgcagcgagctcatcaacgccttcaccatgttgaccgcctacctcgccccc
gtgttgccgcaaaccgccgccaacgccgcgcgtttcctcaatctggacgcgattacttgg
gcgaacacaagggtaaccttgggcgaacacgccatcaacaaatacgaacatttaatgcaa
cgagtggagcaaaaacaagtggacgatttaatcgaagccaacaaacaaagtattcagaca
acccccgcgcctgttgaagacagcaaatacgaaaaagtcgccgaacaggcgggtttcgac
gactttatgaaaatcgatatgcgcgtcgccaaagtattgaactgcgaagccgtcgaaggc
agcaccaaactcctgaaattcgacctcgatttcggttttgaaaaacgtatcatcttctcc
ggcatcgccgcgttttaccccaaccctgccgagttaaacggaagaatggtcattgccgtc
gccaacttcgccccgcgcaaaatggcgaaattcggcgtatccgaaggcatgattttgagt
gccgccacggcagacgggaaactgaaactgcttgatgtcgacgcaggcgcgcaaccgggc
gacaaagtcggttaa

DBGET integrated database retrieval system