KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0687Help
Entry
NMBM04240196_0687 CDS       T01948                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00300  Lysine biosynthesis
nmq01100  Metabolic pathways
nmq01120  Microbial metabolism in diverse environments
nmq01230  Biosynthesis of amino acids
Module
nmq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMBM04240196_0687 (dapE)
Enzymes [BR:nmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NMBM04240196_0687 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADZ01175
Structure
PDB: 

Position
738321..739466
Genome map
AA seq 381 aa AA seqDB search
MTETQSLELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKA
PVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEH
PDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRR
GSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNING
GTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTHAG
KLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINENVRLND
IPKLSAVYEGILARLLAGNAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacccaatccctagaactcgccaaagaattgatttcccgcccatccgttacc
cccgacgaccaaaattgccaaaaactccttgccgaacgcctgcacaaaatcggttttgcg
gctgaagaactccatttcggcgacaccaaaaacatctggttgcgacgcggcacgaaagct
cccgtcgtctgttttgcagggcataccgacgttgtaccgacaggccctgtcgaaaaatgg
gattcgcccccgttcgagccggccgagcgcgacggaagattatacgggcgcggtgcggcg
gacatgaaaaccagcatcgcctgtttcgttaccgcctgcgaacgctttgttgccgaacac
cccgatcatcaaggcagcatcgcgctcctgattacttccgacgaagagggcgacgcgctg
gacggcacgaccaaagtcgtcgatgtgttgaaagcgcgcgacgagcttatcgactactgc
atcgtcggcgaaccgacagccgtggacaaattgggcgatatgattaaaaacggccggcgc
ggctcgctgtcgggcaacctgaccgtcaaaggcaagcaaggccatattgcctatccgcat
ttggcaatcaatcccgtgcatacttttgccccggccttgttagagctgacgcaggaagtc
tgggacgaaggcaacaaatacttcccgccgaccagctttcaaatttccaatatcaacggc
ggtacaggcgcgaccaatgtcattccgggcgagctgagcgtcaaattcaatttccgcttc
tccaccgagtccaccgaagcagggctgaaacaacgcgtccacgccattttggacaaacac
ggtgtgcaatacgatttgcagtggtcgtgttcggggcagcccttcctgacccacgcgggc
aaactgaccgacgtggcacgcgccgccattgccgaaatctgcggcgtagagaccgaattg
tccaccaccggcggcacttcggacggacgcttcatcaaagccattgcaaaagaactcatc
gaattaggcccgtccaatgcgaccatccaccaaatcaatgaaaacgtgcggctaaacgac
attccgaagctgtctgcggtgtatgaggggatattggcgcggttgttggctggaaatgcc
gtctga

DBGET integrated database retrieval system