KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0864Help
Entry
NMBM04240196_0864 CDS       T01948                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00010  Glycolysis / Gluconeogenesis
nmq00020  Citrate cycle (TCA cycle)
nmq00620  Pyruvate metabolism
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01120  Microbial metabolism in diverse environments
nmq01130  Biosynthesis of antibiotics
nmq01200  Carbon metabolism
Module
nmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM04240196_0864 (aceF)
   00020 Citrate cycle (TCA cycle)
    NMBM04240196_0864 (aceF)
   00620 Pyruvate metabolism
    NMBM04240196_0864 (aceF)
Enzymes [BR:nmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMBM04240196_0864 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Methyltr_RsmB-F FAP
Motif
Other DBs
NCBI-ProteinID: ADZ01342
Position
complement(957631..959238)
Genome map
AA seq 535 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAAPAAAEAQPAPAAAPVAAGGATVQVAVPDIGGHTD
VDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGTAIIEV
ETAGSAAAAPAQAAQAAAPAAAPPPTAAAAPAAAPAPSAPAAAKIDEAAFAKAHAGPSAR
KLARELGVDLGQVKGTGLKGRIVGDDIKAFVKSVMQGGAAKPAAAGASLGSSLDLLPWPK
VDFSKFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWERE
GVKLSPLAFIIKASVSALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVD
QKGLKQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGV
CKSQIKPIWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLAKLLKDFRRITL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaaacgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattacactggaa
accgacaaagccacgatggatgtgcctgccgatgcggccggtgtcgtgaaagaagtaaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattttgaccgttgaaaccggtgcc
gccgctgccgaagccgctcctgctgctgccgaagcacaacctgcacctgctgccgcaccc
gttgccgcaggcggtgcaaccgttcaagtagccgttcccgacatcggcggccataccgat
gtggatgtaatcgccgtcgagatcaaagtcggcgataccgttgccgaagacgacacgctg
attactttggaaaccgacaaagcaacgatggacgtaccttgtaccgctgccggtgtcgtt
aaagccgtattcttaaaagtcggcgacaaagtgtccgaaggtactgccattatcgaagta
gaaaccgccggctctgccgcagcagcccctgctcaagccgctcaagctgccgcaccggct
gccgctccgcctccgactgctgccgccgcacccgccgccgcgcctgcaccttctgcacct
gccgctgccaaaatcgacgaggccgctttcgccaaagcacacgccggcccttccgcacgc
aaactggcgcgcgaattgggcgtggatttgggccaagtcaaaggtaccggcttgaaaggc
cgtatcgtgggcgacgacatcaaagcctttgtgaaatccgtaatgcagggtggcgcggca
aaacctgccgcagccggcgcatctttgggcagcagtctggacttgctgccgtggcctaaa
gtggacttctccaaattcggcaatgtcgaagttaaagaattgtcccgcattaagaaaatc
tccggtcaaaacctgtctcgcaactgggtggtgattccccacgttaccgtacacgaagaa
gcagatatgaccgagctggaagaattccgcaaacaactgaacaaagaatgggaacgcgaa
ggcgtgaaactgtcaccgttggcgttcatcatcaaagcctccgtttccgcgctgaaagcc
ttccccgaattcaacgcttctctggacggcgacaacctggtgctgaaaaactacttcaac
atcggtttcgcagccgatacgccgaacggcttggttgttcccgtcatcaaagacgtggat
caaaaaggcttgaaacaaatcagccaagagctgaccgaattgtccaaaaaagcccgcgaa
ggcaagctcaaaccgcaagaaatgcaaggcgcgtgctttaccatttccagcttgggcggt
atcggcggcacaggcttcacgccgattgtaaacgctcccgaagtcgccatcttgggcgtg
tgcaaatcccaaatcaaaccgatttggaacggcaaagagtttgccccgcgcctgatgtgc
ccgttgagcctgtccttcgaccaccgcgtcatcgacggtgcggccggtatgcgctttacc
gtattcttggcgaagctgttgaaagacttccgccgcattaccctgtaa

DBGET integrated database retrieval system