KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1094Help
Entry
NMBM04240196_1094 CDS       T01948                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00330  Arginine and proline metabolism
nmq00332  Carbapenem biosynthesis
nmq01100  Metabolic pathways
nmq01130  Biosynthesis of antibiotics
nmq01230  Biosynthesis of amino acids
Module
nmq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMBM04240196_1094 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMBM04240196_1094 (proB)
Enzymes [BR:nmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMBM04240196_1094 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADZ01560
Position
1200928..1202037
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSITHSDGSLSRGKIQTITRQLAALHHAGHELVLVSSGAVAAGFGALG
FKKRPVKIADKQASAAVGQGLLMEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGAL
SVLLQRRAVPIINENDTVSVEELKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNS
NPDAVRLDKIEHINHEIIEMAGGSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKPDA
LAEAAEHQADGSFFVPRAKGLRTQKQWLAFYSESRGSVYVDEGAEHALSEQGKSLLMSGI
AGIEGHFSRMDTVTVYSKATKQPLGKGRVLFGSAAAEDLLKSRKAKGVFIHRDDWISITP
EIRLLLTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagaatcgtatttaaagtcggcacatcttcgattacccattcggacggc
agtctctcgcgcggcaaaatccaaaccatcacccgccagcttgccgcattgcatcatgcg
ggacacgagctggtcttggtgtcttccggcgcggttgcggcagggttcggtgcgctgggt
ttcaaaaaacgtccggtcaaaatcgccgacaaacaggcttccgccgccgtcgggcagggg
ctgctgatggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcacaaatc
ctgctcagccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactt
tccgtgctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggtt
gaggaattgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacag
gcagacctcttggtgctgctgaccgacatagacggtctttacacgggcaacccgaacagc
aatcccgatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatg
gcgggcggatcgggttcggcaaacggcacgggcggtatgctgaccaaaatcaaagcggca
accatcgccgccgaatccggcgtaccggtgtatatctgttcctcgctcaaacccgatgca
cttgccgaagctgccgaacatcaggcggacggctcgtttttcgtcccccgtgccaaaggt
ttgcggacgcagaagcaatggctggcgttctattccgaaagccggggcagcgtttatgtg
gacgaaggtgcggaacacgctttgtccgaacaggggaaaagcctgctgatgtcgggcatt
gccggaatcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaacc
aaacagcccctgggcaaagggcgcgtcctgttcggttctgccgccgccgaagacctgctc
aaatcgcgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgccc
gaaatacgcctgcttctgaccgaattttag

DBGET integrated database retrieval system