KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1561Help
Entry
NMBM04240196_1561 CDS       T01948                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMBM04240196_1561
Enzymes [BR:nmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NMBM04240196_1561
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NMBM04240196_1561
    1.1.1.-  
     NMBM04240196_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N Pyr_redox_2 NAD_binding_2 2-Hacid_dh_C Semialdhyde_dh 3HCDH_N AdoHcyase_NAD DUF3335 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ADZ02000
Position
1657237..1658301
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIVHDDVPTGPGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATVNVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELVSEGFERLIHNNESAVKIIVSPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgacaaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcaccgtcggcatcaatgttgcctggtgcggcatctgcggtaccgac
ctgcacgaattcatggaaggcccgattttcattccgccttgcggtcatccgcacccgatt
tccggcgagtccgcacccgtcacgatgggacacgagttctccggcgtggtctatgccgtc
ggcgaaggcgtggacgacatcaaagtcggccaacacgtcgtggtcgagccttacatcgta
cacgacgacgtaccgaccggcccgggcagcaactaccacctctctaaagacatgaacttc
atcggcttgggcggctgcggaggtggcttgtctgaaaaaatcgctgtcaaacgccgttgg
gtgcatccgatttccgacaaaatcccgttggatcaagccgctttgatcgaaccgctgtct
gtcggacaccacgcctatgtacgcagcggcgcgaaagcaggcgacgtcgcattggtcggc
ggcgcaggtccgatcggtttgctgttggctgccgtgttgaaagccaaaggcatcaaagtc
atcatcaccgagttgagtaaagcacgcaaagacaaagcgcgcgaatccggcgttgccgac
tacatcctcgacccgtccgaagtcgatgttgtcgaagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtggcattcgaatgtaccagcgtgaacaaagtgttggatactttggtc
gaagcctgcaaacctgccgccaatttggttatcgtatccatctggagccaccctgcaacc
gtcaacgtccacagcgtcgtgatgaaagaactggatgtgcgcggcacgattgcctactgt
aacgaccacgccgaaaccatcaaactggtcgaagaaggcaaaatcaacctcgagcctttc
atcacccagcgcatcaagctggacgaactggtttccgaaggcttcgagcgtctaatccac
aacaacgaatccgccgttaaaattattgtgagtccaaacctgtaa

DBGET integrated database retrieval system