KEGG   Nitrosopumilus maritimus: Nmar_0206Help
Entry
Nmar_0206         CDS       T00626                                 

Definition
(GenBank) CoA-binding domain protein
  KO
K18593  4-hydroxybutyrate---CoA ligase (ADP-forming) [EC:6.2.1.56]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00720  Carbon fixation pathways in prokaryotes
nmr01100  Metabolic pathways
nmr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmar_0206
Enzymes [BR:nmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.56  4-hydroxybutyrate---CoA ligase (ADP-forming)
     Nmar_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2 CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABX12102
UniProt: A9A1Y1
Position
182783..184879
Genome map
AA seq 698 aa AA seqDB search
MTDSPILSPKSIAVIGASDKRGSVGATITSNIMNGFKGTVYPISPTRDTVFYKKAYKSVL
DVPKSIDLAVIVIKNTLVTPVLEECGKKKIKGVIIITAGFKEVDEEGAKREQQVIDIAKK
YNMQVVGPNCLGVMNLDSKTMMNSTFLKVTPKSGKIALVSQSGAICAALVEDASAQGIGF
SAVVSLGNKAVMSEVDVLKILANHKQTEVIVMYLEDMGDGQEFLKVCKNITKKLKKPVLV
LKSGRSPEGAKAAMSHTGALMGSDEIYDALLKQSGAIRVDTMEELFDYATAFSKQPLPSN
GDLVIVSNAGGPAIISTDACSKAKIKMADITSIRKKIDEVIPPWGSSRNPVDIVGDADFN
RFHNVLDRVLKHPKVGSVISMCTPSGTLNYDKLAEVIVEMSKKYKKTMLASLMGLDEGVT
NREILADGNVPYYTYAEGAIRTLAAMIRFSDWVKSSPGKITKFKVNKAKAKKIFDQVKKE
KRPNLLEEEGQEVLKAYGLPLPKSTLAKNEAEAVKAAKKIGYPVVMKIASPQIIHKSDAG
GVKVNLTNDAEVKDAFKTIVKNAKKYNKKAEIKGVLIVEMVKGGKELIIGSKLEPGFGPV
IMLGMGGIYVEVLKDVTFKLAPVTDKEADDMIASIKTQKLLQGVRGEKPSDIVKLSECIQ
RLSQLVSDFKEIKELDMNPVLVMEKGKGCRILDVRIGL
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgactgattctcctattttatcaccaaaatcaattgcagtaattggtgcatctgataag
agaggaagtgttggtgctactattacatcaaatattatgaatggtttcaagggaacagta
taccctattagtcctacaagagacactgtattttacaaaaaagcatacaagagtgtttta
gatgttccaaaatcaattgatcttgcagttattgttatcaaaaatacacttgttactcct
gttttagaagaatgtggaaagaagaaaatcaaaggcgtaattatcataacagctggtttc
aaagaagtagatgaagaaggagcgaaaagagaacaacaagtcatagacattgcaaaaaaa
tacaacatgcaagttgttggacctaattgccttggtgtcatgaatcttgattcaaaaaca
atgatgaattctacttttcttaaagttacaccaaagtctggaaaaattgcacttgtttca
caaagcggagcaatttgtgctgcactagttgaagatgctagtgcacaaggaattggattc
tcagctgttgttagtcttggaaacaaagctgtaatgagtgaagtcgacgttctaaaaatt
cttgcaaatcacaaacaaacagaggttattgtaatgtatcttgaagatatgggtgatggc
caagaattcctcaaagtttgtaaaaatattactaaaaaactcaaaaaacctgttctagtt
cttaaatctggacgcagtcctgaaggtgcaaaagccgcaatgtctcatactggagcctta
atgggttcagatgaaatctatgatgcattactgaaacaatctggtgcaatccgagttgat
actatggaagaactatttgattatgcaacagcattctcaaaacaacctttaccatctaat
ggtgatttagtaattgtatcaaatgctggtggacctgcaatcatttctacagatgcatgt
tcaaaggcaaaaatcaaaatggcagatattacaagtataagaaagaaaattgatgaagta
attcctccttgggggagttctagaaatcctgttgatattgttggtgatgctgattttaat
agattccataatgttttggaccgtgtcttaaaacatccaaaagttggttctgttatctca
atgtgtacaccttctggtacgctgaattatgataaacttgcagaggttattgttgagatg
tcaaaaaaatacaaaaaaaccatgcttgcaagtttaatgggattagatgaaggagttact
aatagagaaatcttagctgacggaaatgttccatattatacttatgcagaaggtgctatc
cgaactcttgctgctatgattagattctctgattgggttaaatcttctcctggtaaaatt
accaaattcaaagtaaacaaagcaaaggccaaaaaaatatttgatcaagttaaaaaagaa
aaaagaccaaatctcttagaagaagaaggacaagaagttctcaaagcatatggtttgcca
cttcctaaaagtacacttgctaagaatgaagcagaagctgtaaaggctgcaaaaaagatt
ggttatccagttgtaatgaaaattgcatctcctcaaattattcacaaatctgatgcaggt
ggtgttaaagtcaatttaacaaatgatgctgaagtaaaagatgctttcaaaactattgta
aagaatgctaaaaagtacaacaagaaagccgagataaagggtgttttgattgtcgagatg
gtcaaaggtggaaaagaattgatcataggctccaaattagaacctggatttggtccagta
attatgcttggtatgggtggaatatacgtagaggttctcaaggatgtaacattcaaactt
gctccagtaactgataaggaagctgatgatatgattgcatcaattaaaactcaaaaacta
ctacaaggagttcgaggtgagaaaccatctgatattgtaaaactctctgagtgtattcag
agattatctcaactagtttctgactttaaagagatcaaagaattggacatgaatcctgta
cttgtcatggaaaaaggtaagggttgcagaattttagatgtccgaataggtctttga

DBGET integrated database retrieval system