KEGG   Nitrosopumilus maritimus: Nmar_0412Help
Entry
Nmar_0412         CDS       T00626                                 

Definition
(GenBank) Glyoxylate reductase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00630  Glyoxylate and dicarboxylate metabolism
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmar_0412
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     Nmar_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABX12308
UniProt: A9A5A9
Position
complement(369607..370575)
Genome map
AA seq 322 aa AA seqDB search
MRKKVFLTRTLHDFALKELKKKYQIEVHKGKIPVPQSKLRSKIKDVDGLICFPYDIINKE
TIDLAENLKVISTYSVGFDHIDTKYAKGKKIRVGYTPEVLTDATADLAFSLLLDSLRRVS
EGDRIIRDGKWKMIYGAHDYVGVDLQGKTIGILGLGRIGQTLAKRAKAFDMDIIYHNRNR
LSKTKERTLDAKYVSFERLISQSDVISIHVPHTKETDKMFNMKIFKKMKNTAFLINTSRG
KVVNEKDLVTALKKKIIAGAGLDVFEQEPISKNHPLTKLQNVVLAPHIGSSTKETRAKMA
EITVRNLNLGMNGKKPIYSVGY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaaagtgtttctaacaagaacacttcacgattttgctttaaaggaattaaag
aaaaaatatcaaattgaagtacataaaggaaagattccagttcctcaatcaaagttacga
tcaaaaattaaagatgtagatggattgatctgttttccatatgacataatcaataaagaa
acaatagatttggcagagaatctcaaagtcatcagtacatacagcgtaggttttgatcat
attgatacaaaatatgcaaaaggaaaaaagatcagagtgggatacactcccgaagtatta
actgatgcaacagcggatttggctttttcactattacttgattcattaagaagggtttca
gagggagacagaataatcagagatggaaaatggaaaatgatctatggagcacatgactat
gtaggagttgacctacaaggaaaaactataggaattttaggattaggaagaattggacaa
acacttgcaaagagagctaaagcatttgatatggatataatttatcacaatagaaatcgt
ctatcaaagactaaagagagaacattggatgcaaaatacgtctcatttgagaggttaatt
tctcaaagtgatgtcatttcaatccacgttccacatacaaaagagactgacaagatgttt
aacatgaaaatcttcaaaaaaatgaaaaacactgcatttttgataaatacatcaagaggc
aaagtggtaaatgaaaaagacttggttactgcattaaaaaagaaaattattgcaggagca
ggactagatgtctttgaacaagaaccaataagcaagaaccatccactgacaaaattgcaa
aatgtggtactggcaccacacatagggagttcgactaaggagaccagagccaaaatggca
gaaattactgtaagaaatctcaatctaggaatgaatggaaaaaaaccgatctactcagta
ggatattga

DBGET integrated database retrieval system