KEGG   Nitrosopumilus maritimus: Nmar_0509Help
Entry
Nmar_0509         CDS       T00626                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00860  Porphyrin and chlorophyll metabolism
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01120  Microbial metabolism in diverse environments
Module
nmr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nmar_0509
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Nmar_0509
Exosome [BR:nmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nmar_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABX12405
UniProt: A9A1Z2
Position
complement(456304..457284)
Genome map
AA seq 326 aa AA seqDB search
MSFPTRRLRRLRTSEKMRELVQETRLSPSDLICPIFVQEDIKTRIKIESMPSIERLPLDD
VTDEVGTISDLGIPAIMLFGIPSNKDETGSSAFDDNGIVQKAISQVRENFGDKIVIMADT
CLCQFTSTGHCGVISNNKVDNDASLELLAKTAVSQAKAGMDTSSPSAMMDGQVAAIRNAL
DDEGFSDVSIMSHAAKHRSNFYSPFRDAAACAPEFGDRKTYQMPYTNAREAMMEVETDIN
EGVDIVMIKPALSYLDLISETRRRFNIPVAAYSVSGEYALVKAASQLGYVNENEVTDEIL
SSIKRAGADMIVTYFAKSAAKFMQES
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcctactagacgtctaagaagactaagaacatcagagaagatgagagaatta
gttcaagagactagactgtctccaagtgatttgatttgtccaatttttgttcaagaggac
ataaaaactagaatcaaaattgaatcaatgccatcaattgaaagacttcctttagacgat
gtcacagacgaagttggaactattagtgatttaggaattcctgcaatcatgttatttgga
attcctagtaacaaagatgaaacaggttcatcagcatttgacgataacgggattgtacaa
aaggcaatttctcaagttagagagaattttggagacaaaatagtaattatggcagatacc
tgtctatgtcaatttacatctacaggacattgtggagttatttctaacaataaagtcgat
aatgatgcaagtcttgaacttttagcaaaaacagcagtaagccaagcaaaagctggaatg
gatacatcatcaccatcagcaatgatggacggtcaagttgcagcaataagaaatgcatta
gatgatgaaggtttctcagatgtttcaataatgtctcatgctgcaaaacatcgttcaaat
ttttattcaccttttagagatgcagcagcatgtgctccagaattcggagatagaaaaaca
taccaaatgccttacaccaacgcaagagaagcaatgatggaagttgaaactgacattaat
gaaggagtagacattgttatgataaaaccagcattatcttatttggatttgatatctgaa
acaagaagaagattcaatattccagtagctgcatacagcgtttctggagaatatgcattg
gtaaaagcagcttcacaattaggatatgtaaatgaaaatgaggtcactgatgagatcttg
tcttccattaaaagagcaggggcagacatgattgttacttattttgcaaaatctgctgca
aaattcatgcaagaatcatga

DBGET integrated database retrieval system