KEGG   Nitrosopumilus maritimus: Nmar_1125
Entry
Nmar_1125         CDS       T00626                                 

Definition
(GenBank) 50S ribosomal protein L40e
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Nmar_1125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nmr03011]
    Nmar_1125
   04121 Ubiquitin system [BR:nmr04121]
    Nmar_1125
Ribosome [BR:nmr03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Nmar_1125
  Archaea
    Nmar_1125
Ubiquitin system [BR:nmr04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   Nmar_1125
SSDB
Motif
Pfam: Ribosomal_L40e zinc_ribbon_2 DZR zf-ribbon_3 zf-tcix
Other DBs
NCBI-ProteinID: ABX13021
UniProt: A9A4P3
Position
1029001..1029168
AA seq 55 aa
MPITDPEKKRIAQQARLVMRICFNCGARNDVGATRCRKCRNPYLRLKNRNLGVKK
NT seq 168 nt   +upstreamnt  +downstreamnt
atgccaatcacagacccagaaaagaaacgaattgcacagcaagctagacttgtcatgaga
atttgttttaattgtggggcacgaaacgatgttggcgctactagatgcagaaaatgcaga
aacccatacttgagattaaagaacagaaatctcggcgtaaagaaatag

DBGET integrated database retrieval system