KEGG   Nitrosopumilus maritimus: Nmar_1468Help
Entry
Nmar_1468         CDS       T00626                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00790  Folate biosynthesis
nmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmar_1468
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nmr04147]
    Nmar_1468
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Nmar_1468
Exosome [BR:nmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nmar_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABX13364
UniProt: A9A3V2
Position
1335364..1335639
Genome map
AA seq 91 aa AA seqDB search
MRLSPEEITEELKNLPGWSVVNEKLHKEIEFESFNQAFGFMTRAAMEIEKMNHHPEWFNV
YNRLVIDLMTHDAGGITKNDINLARILNSLL
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgagattatcacctgaagagattacagaggagctcaagaatctaccaggatggagtgtt
gtaaatgagaaactacacaaagaaattgaatttgagagtttcaatcaggcatttgggttt
atgaccagagctgcaatggagattgaaaagatgaatcatcatccagagtggtttaacgtg
tataatagactcgtaatagatttgatgactcacgatgctggcggcattacaaaaaatgac
atcaatctggctcgaatcctaaattccctactttga

DBGET integrated database retrieval system