KEGG   Nitrosopumilus maritimus: Nmar_1511
Entry
Nmar_1511         CDS       T00626                                 

Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nmar_1511
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmr01007]
    Nmar_1511
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmr03016]
    Nmar_1511
Enzymes [BR:nmr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     Nmar_1511
Amino acid related enzymes [BR:nmr01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Nmar_1511
Transfer RNA biogenesis [BR:nmr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Nmar_1511
 Prokaryotic type
    Nmar_1511
SSDB
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N FlaC_arch Rb_C
Other DBs
NCBI-ProteinID: ABX13407
UniProt: A9A4V3
Position
1373878..1375143
AA seq 421 aa
MLDPKLLKEKPQVIRDMLKARAVDFDLDGLIESDQKRREFIIKTDEFKKRRNEIGNEIAQ
KKKAGEDTSTILDEMKNVSAELAKLESQQEEIESKYAKLAFTVPNLVHESVPVGPDDTAN
KEMRKWGEIPQFDFKINDHIDMSENLDLVDLERAAKVAGARFYYLKNDLVRLNQSLIHFA
LDFLAEKEYSLVQPPYMINRSSMEGAVIADDFEEVIYKVEEEDLYMIGTSEHAMAAMHSK
EIIEGKDLPIRYAGVSPCFRKEAGAHGRDQKGIFRVHQFDKIEQFVYARPEDSWKEHEKM
LAVAEEFYQKLEIPHRVMLLSTGDMGKISAKTYDIEAWMAGQNSYREIVSCSNCLDYQAR
RLKIRFRDKTNEDTQYIHTLNSTLVATTRVLVSIMENFQTKDGHIKIPQVLQSYMGNQKE
I
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgctagacccaaaactactcaaagaaaaaccacaggtgatcagagacatgctcaaggca
agagcagtagattttgatttggatggattgatagagtctgaccaaaaaagacgagagttt
atcataaaaactgacgagttcaaaaagagaagaaatgagattggaaatgaaatcgctcaa
aagaaaaaggcaggagaagacacatcgacaattctagatgagatgaaaaatgtctcagca
gaacttgcaaaactagaatcacaacaagaagagattgaaagtaaatatgcaaaattagca
tttacagttccaaacttggttcacgaatcagttccagtaggacctgatgatactgcaaac
aaagagatgagaaagtggggagagattccacagtttgattttaagataaatgatcacatt
gacatgtctgagaatttggatttggtagatttagagagagcagccaaagttgcaggtgcc
agattctattatctcaaaaatgatttggtaagactaaaccaatcactaattcactttgca
ttagactttttagcagaaaaagagtattcgctagtacaaccgccatacatgattaatcgc
tcatcaatggaaggcgcagtaattgcagatgactttgaggaagtaatctacaaagttgaa
gaagaggatctctacatgattggtacatcagagcatgcaatggcagcaatgcactctaaa
gagattattgaaggaaaagatcttccaataagatatgccggagtaagtccatgttttaga
aaagaagcaggagcacatggcagagaccagaaaggaatctttagagtccaccagtttgac
aagattgaacagtttgtctatgcaagacctgaagactcttggaaagaacatgaaaagatg
ttggcagtagctgaagagttttaccagaaactagagattccacacagagtcatgttattg
tcaactggagacatgggaaagatttctgccaagacatacgatattgaagcatggatggca
ggacaaaattcctatagggaaatagtatcgtgttcaaactgccttgattaccaagcaagg
agactcaaaatcagattcagagacaagacaaatgaagacacacagtacatccacacatta
aacagcacactggtagccacaaccagagtactggtatcaattatggagaatttccagaca
aaggatggccatatcaaaattcctcaagttttacagagttacatgggaaatcagaaagag
atctag

DBGET integrated database retrieval system