KEGG   Nitrosopumilus maritimus: Nmar_1558Help
Entry
Nmar_1558         CDS       T00626                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00340  Histidine metabolism
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Nmar_1558
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nmar_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HTH_Tnp_IS630
Motif
Other DBs
NCBI-ProteinID: ABX13454
UniProt: A9A5X6
Position
complement(1425594..1426856)
Genome map
AA seq 420 aa AA seqDB search
MKIISINNTEQFLKKIGTKDSSKNQKIVKSILKDVKKNGDVAVKKYEKKFSAKVSSLRVS
QRDIASAYFKVSKEDISAIKLAKSRLSKAESAVRRQFKDITIKSNGTKLSKSFVPIDSVG
CYVPGGAARYPSSAIMSVVPAKIAGVKRIVVVSPPNSSGNIDPLTIVAADLCGATEIYKT
GGVQSIAALTYGTRSIKKVNKIVGPGGAFVTLAKYLVSNIVSIDMMAGPTELGIVIDSAA
DVDVAALDLISQAEHSSDTFCYALTTSNSIAKKIQSSVNSKLKDIQRVKIVKSSLESNGF
IGVCKPSDIIDIANDLAPEHLEIISKNPKKWNKIKNPGLILYGKNSPSSASDYLLGSNHI
LPTNGFGKTRGSLSVLDFVKLLTKIETTKKDLQKISKSMKNLTLAEGLPNHYEAVRGRLK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcatttcgataaataatacagaacaattcctaaagaaaataggcacaaaagac
tcttctaagaaccaaaaaattgtaaaatctattctcaaagatgtaaagaagaatggtgat
gttgctgtcaaaaaatatgaaaaaaagtttagcgcaaaagtttcatcactaagagtttct
caacgtgacattgctagtgcatactttaaagtttcaaaagaagacatctctgcaatcaaa
cttgcaaaatcaagattatcaaaagcagaatctgcagtacgacgtcaattcaaagacatt
actatcaaatcaaatggaacaaaactctcaaaatcatttgtcccaattgatagtgtagga
tgttatgtaccaggtggtgcagcaagatatcctagttcagctataatgtccgtagtacct
gcaaagattgcaggtgtaaaaagaattgttgttgtatctccacctaactcttcaggaaat
attgatcctttaacaattgtggcagctgatctttgtggtgcaactgaaatctacaaaaca
ggcggtgtgcaatcaattgctgcattaacatatggtactcgttctatcaaaaaagtaaac
aagatagttggaccaggtggtgcttttgttactttggcaaaatatcttgttagcaacatt
gtgtctattgatatgatggcaggacctactgaattgggaattgtaattgattctgcagca
gacgttgatgtcgcagcattagaccttatttcccaagcagaacactcttcagatacattt
tgttatgcattaactacgtcaaattcaatcgcaaaaaaaattcaatccagtgtaaactct
aaacttaaagatattcaacgtgtaaaaattgtcaaatctagtcttgaatcaaatgggttc
attggtgtttgcaaaccctctgatattatcgatattgcaaatgatctggcacctgaacac
ttggaaattatcagcaaaaatcctaaaaaatggaataaaatcaagaatcctggcttgata
ttatatggaaaaaacagtccttcttctgctagtgactatttgttaggctcaaaccacatt
ctgcccacaaatggatttggtaaaacgagaggttctttgtctgtgctagactttgtcaag
ctcttaacaaagatagaaacaaccaaaaaagatttgcagaaaatatcaaaatctatgaag
aatctaactttagcagaaggattgccaaatcactatgaagcagtaagaggtagattgaaa
tga

DBGET integrated database retrieval system