KEGG   Nitrosopumilus maritimus: Nmar_1560Help
Entry
Nmar_1560         CDS       T00626                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00900  Terpenoid backbone biosynthesis
nmr01110  Biosynthesis of secondary metabolites
nmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nmar_1560
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Nmar_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red PCI SseC
Motif
Other DBs
NCBI-ProteinID: ABX13456
UniProt: A9A5X8
Position
complement(1427870..1429126)
Genome map
AA seq 418 aa AA seqDB search
MPDSSISKFFEKTRTERLDVIKNFANLSEDDVKSLELPDGGITFDKADKMVENAFGTFSL
PLGVATNFKINNKDYLVPMVIEEPSVIAAASKAAKLARPKGGFAVVADESYSIGQIQVLG
TDIDNAISKIKENIKEILELANSKSNTLSKMGKGAKEITCKKLDTDFEPMLIVELLIDVG
DAMGANVTNTMCEGVAPLIEKLTSGKTLLRILSNYSTRRMVKATAVFDKESVGGEKVVDN
MIHAYQFAKHDVYRAVTHNKGIMNGIIAVANATGQDSRAIEAAANAYASRSGQYRSLSEW
TKDSDGNLVGTLEIPLSVGIVGGIINVHPVAKICTKILGAESAKEMACIITATGLAQNFS
AMRALATDGIQKGHMRLHARNLASAAGASTEQIDKIVSQMIEENNISVNRAKELLEQN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattcgtccatttcaaaattttttgaaaaaacaagaacagaaagattagatgtt
atcaaaaattttgcaaatctttcagaagatgacgtaaaatcattagaactaccagatggc
ggaattacatttgataaagcagacaaaatggtggaaaatgcgtttggaacattttcactt
ccactaggagttgcaaccaacttcaaaattaacaataaagattatcttgttcccatggtg
attgaagagccttctgtgattgcagcagcatcaaaagcagcaaaacttgcaagacctaaa
ggtggatttgcagtagtagctgatgaatcctacagtattgggcaaattcaagttttaggc
acagatattgataatgctatttctaaaattaaagaaaacattaaggaaattctagaactt
gcaaattcaaaaagtaatactctttctaagatgggaaaaggtgcaaaagagattacttgt
aaaaaacttgatactgattttgaaccaatgttaattgttgaattattaattgatgtgggt
gatgcaatgggtgcaaatgttactaatacgatgtgtgaaggtgtagcaccattaattgaa
aaattaactagtggaaaaacacttcttcgaattttatcaaactattccacaagacgaatg
gtaaaggcaactgctgtatttgacaaagaatcagttggaggcgaaaaagttgtagataac
atgattcatgcatatcaatttgcaaaacatgatgtgtatagagcagtaactcacaacaaa
ggaattatgaatggaattattgcagtagctaatgctacaggacaagacagtcgtgcaatt
gaagctgcggcaaatgcatatgcatcacgttctggacaataccggtcgctatcagagtgg
actaaggattcagatggaaatcttgttggtacattggaaatcccattatctgttggcatt
gtaggtggaataatcaatgttcatccagttgcaaaaatctgtactaaaattttaggcgca
gaatctgcaaaagagatggcatgtataataactgcaacaggattggctcaaaactttagt
gccatgagggcacttgcaactgatggaattcagaaaggacacatgaggctacatgcaagg
aatctagcatctgcagcaggtgcttctactgaacaaattgacaagatagtttctcagatg
attgaagaaaacaacatttcagtaaatagagcaaaagaactgcttgaacaaaattaa

DBGET integrated database retrieval system