KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0033Help
Entry
NMBM01240355_0033 CDS       T01947                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00450  Selenocompound metabolism
nms00970  Aminoacyl-tRNA biosynthesis
nms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nms00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMBM01240355_0033
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMBM01240355_0033
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nms01007]
    NMBM01240355_0033
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nms03016]
    NMBM01240355_0033
Enzymes [BR:nms01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NMBM01240355_0033
Amino acid related enzymes [BR:nms01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NMBM01240355_0033
Transfer RNA biogenesis [BR:nms03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMBM01240355_0033
 Prokaryotic type
   Other AARSs
    NMBM01240355_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ADY98617
Position
complement(27060..29117)
Genome map
AA seq 685 aa AA seqDB search
MTRKILVTSALPYANGSIHLGHMVEHIQTDVWVRFQKLRGNECHYCCADDTHGTPVMLAA
QKQGIAPEDMIAKVREEHLADFTGFGIGYDNYYSTHSPENKQFSQDIYRALKANGKIESR
VIEQLFDPEKQMFLPDRFVKGECPKCHTRDQYGDNCEVCGTTYSPTELINPYSAVSGAKP
ELRESEHFFFKLGECADFLKAWTSGNNPHDGKPHLQPEALNKMKEWLGEGEETTLSDWDI
SRDAPYFGFEIPDAPGKYFYVWLDAPVGYMASFKNLCDRIGVDFDEYFKADSQTEMYHFI
GKDILYFHALFWPAMLHFSGHRAPTGVYAHGFLTVDGQKMSKSRGTFITAKSYLEQGLNP
EWMRYYIAAKLNSKIEDIDLNLQDFISRVNSDLVGKYVNIAARASGFIAKRFEGRLKDVA
DSALLAKLAAESDTIAEQYENREYARALRDIMALADAVNEYVDANKPWELAKQEGQDERL
HEVCSELINAFTMLTAYLAPVLPKVAENAAKFLNLEAITWANTRETLGKHAINKYEHLMQ
RVEQKQVDDLIEANKQSIAAAAAPAAEEGKYEKVAEQASFDDFMKIDMRVAKVLNCEAVE
GSTKLLKFDLDFGFEKRIIFSGIAASYPNPAELNGRMVIAVANFAPRKMAKFGVSEGMIL
SAATADGKLKLLDVDAGAQPGDKVG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaaaatcctcgttacctccgccctgccctatgccaacggcagcatccacctc
ggccacatggtcgaacacatccaaaccgacgtttgggtgcgctttcaaaaactgcgcggc
aacgaatgccactactgctgcgccgacgacacccacggcacgcccgtgatgcttgccgcg
caaaaacaaggcatcgcgcctgaagacatgattgccaaagtacgcgaagagcacctcgcc
gactttaccggtttcggcatcggctacgacaattattacagcacccattcccctgaaaac
aaacagttttcccaagacatttaccgcgcgctgaaagccaacggcaagattgagagccgc
gtcatcgagcagcttttcgaccccgaaaaacaaatgttcctgcccgaccgcttcgtcaaa
ggcgaatgccccaaatgccacacccgagaccaatacggcgacaactgcgaagtctgcggc
acgacctattccccgaccgaactgatcaacccgtattccgccgtttccggtgccaaaccc
gaattgcgcgaatccgaacacttcttcttcaaactgggcgaatgcgccgacttcctcaaa
gcatggacttccggcaacaacccgcacgacggcaagccccatctgcaaccggaagccctc
aacaaaatgaaagaatggctgggcgaaggcgaagaaaccaccctatccgactgggacatc
tcccgagatgcgccgtatttcggttttgaaatccccgacgcgcccggcaaatacttctac
gtttggctggacgcgcccgtcggctacatggcgtcgtttaaaaacctgtgcgaccgtatc
ggcgtcgatttcgacgaatacttcaaagccgacagccaaaccgagatgtaccatttcatc
ggcaaagacatcctctatttccacgccctgttctggcccgccatgctgcatttctccggc
caccgcgccccgaccggcgtgtacgcacacggctttttgaccgtagatggacaaaaaatg
tccaaatcgcgcggcacgtttatcaccgccaaatcctatttggagcaaggtttaaaccct
gagtggatgcgctactacatcgccgccaaactcaacagcaaaatcgaagacatcgatttg
aacctgcaagactttatctcacgcgtaaacagcgacctcgtcggcaaatacgtcaacatc
gccgcccgcgcctcaggttttatcgccaaacgctttgaaggccgtctgaaagacgttgcc
gacagcgcattgctggcaaaacttgccgccgaaagcgacaccatcgccgagcaatacgaa
aaccgcgaatacgcccgcgccctgcgcgatatcatggcattggcagatgccgtgaacgaa
tacgttgatgccaacaaaccttgggaactggcgaaacaggaaggtcaagacgaacgcctg
cacgaagtgtgcagcgagctcatcaacgccttcaccatgttgaccgcctacctcgccccc
gtcttgccgaaagtggccgaaaatgccgccaaattcctgaatttggaagccatcacttgg
gcaaatacacgcgaaaccttgggcaaacacgccatcaacaaatacgaacatctcatgcaa
cgagtggagcaaaaacaagtggacgatttaatcgaagccaacaaacaaagcatcgccgcc
gcagccgcacctgccgccgaagagggcaaatacgaaaaagtcgccgaacaggcgagtttc
gacgactttatgaaaatcgacatgcgcgttgccaaagtattgaactgcgaagctgtcgaa
ggcagcaccaaacttttgaaattcgacctcgatttcggttttgaaaaacgcatcatcttc
tccggcatcgccgcgtcttacccaaatcctgccgaattgaacggccgcatggtcatcgcc
gtcgccaacttcgccccgcgcaaaatggcaaaattcggcgtatccgaaggcatgattctc
tccgccgccacggcagacgggaaactgaagctcttggatgtggatgcaggcgcgcaaccg
ggcgacaaagtcggttaa

DBGET integrated database retrieval system