KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0786Help
Entry
NMBM01240355_0786 CDS       T01947                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NMBM01240355_0786 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nms03400]
    NMBM01240355_0786 (recB)
Enzymes [BR:nms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NMBM01240355_0786 (recB)
DNA repair and recombination proteins [BR:nms03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NMBM01240355_0786 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 AAA_30 ResIII
Motif
Other DBs
NCBI-ProteinID: ADY99324
Position
complement(840302..843916)
Genome map
AA seq 1204 aa AA seqDB search
MSAPIQAFDPLTVPISGTNLIEASAGTGKTYGIAALFTRLIVLEQKSVERVLVVTFTKAA
TAELKTRLRARLDDVLQVLESKGIAKLGDDTLSDGIAAYCAEHHEGDTFLPELLKQALQK
EGRTRLIVRLKAAIGQFDNAAIYTIHGFCQRILRDYAFLCQAPFDVELTEEDGDRLLIPA
QDFWRERVSNDPVLAALAFKRKAVPQTVLAQISRYLSRPYLNFRRPQADLKQAQRNAETS
WQTICRLLPELEAGFWRIHPDLNGNSYRKNSFGNLFKELAQKSAAGQLPFLDKDTHDRLL
KLASDKLEAGLKKGKTPDAAVFAELQKLADFGRDLNALEEAEEATMIRLQLDLIEYLNRS
LAEMKKSRRERGFDDLLLDVHTALTDNPHAETLARAVAENWETALIDEFQDTDPLQYEIF
QKIFIAQNRPLFLVGDPKQAIYSFRGADIYAYLQAAEDARHRYTLATNYRSHAALIGSIG
ALFRLKERPFVLENIGYSEVGAARAESRLSPKRPAVQVRWLHENDNEKANKDVLRRRAAD
YCADEIAHALNEAAGGRLNFKGCPLQSGDIAVLVRTHNEAVMVSAALKKRQVQSVLLSRE
SVFASPEAAALSALIGFWLEPRRAGTLRFVLTSSIFGYNAQQLHDFNQNESEILHWAESA
RTALDNWNQYGIFAAMQQFSQTHGIETRLLSRNNGRSLTNYFQLLELLAAEDAQNRNPAA
LHKWLRDQISLAGNNGGDNRAIRLESDEDLVKIVTMHASKGLQYPLVYCPFAWDAQDTGP
SDWQILHQSANRTELLAKAQLSEDEQKQHADEEMAERLRLLYVALTRAEEQLNIYAAYST
NTADNPLAYLIEGLPQDSRETVRCAYACEKDGIAMLKRNWQRLTDNAPSGTDFAFTEDVP
PPAVYCGNAGQTAEFAANSIPERGFRFVRHTSFTALSRHTQTPDGGEEDACPSLDAAETS
VPAMPSETPTASDGISIHNFPKGTQAGLCLHEILEDFKFGQAAARQETLIADKLKKYGFE
EIWLPAVAEMAEACQKTPLTGAYGLSDIPPECRCPEMGFTLHTEDFGLKRLRDWFARDDV
RLPEVCRAAAETLDFHTVNGFLNGFIDMVCQDPDGNICVIDYKSNHLGADASAYTQQAMD
EAVTHHHYYLQALIYAVAAARYFKLRGQPPAAVSVRYLFLRGLDGKGGGVWRWDIDAAAL
EQIK
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacccatccaagcattcgacccgctgaccgtccccatttccggcaccaacctg
attgaggcctctgccggcaccggcaaaacctacggcattgccgccctgtttacgcgccta
atcgtattggaacaaaaaagcgtcgagcgcgtattggtcgtaacctttaccaaagccgcc
accgccgagctgaaaacacgcctgcgcgcacgtttggacgatgtgttacaagttttagaa
agcaaaggaattgccaaacttggagacgacacgctttcagacggcatcgccgcctactgc
gccgaacaccacgaaggcgacaccttcctgcccgaactcttaaaacaggctttgcaaaaa
gagggccggacgcgtctgattgtccgcctcaaggccgccatcgggcaattcgacaacgcc
gccatctataccatccacggcttctgccagcgcatcctgcgcgactacgccttcctgtgc
caagcaccgttcgatgtcgaactgaccgaagaagacggcgaccgcctgcttatcccggcg
caagatttttggcgggaacgcgtcagcaatgatccggtgcttgccgcattggcgtttaaa
cgcaaagctgtgccgcaaaccgtccttgcccaaatttcgcgctatctttcccgcccgtac
ctgaatttccgccgtccgcaggcggatttgaaacaggcgcagcgcaacgccgaaacctca
tggcaaaccatctgccgcctgctgccagaactggaagccggcttttggcgcattcatccc
gacctcaacggcaacagttaccgcaaaaacagcttcggcaacctttttaaagaactggca
caaaaatccgccgccggacaactgccctttctggacaaagacacacacgacagactcttg
aaacttgcgtccgacaaactcgaagccggactgaaaaaaggcaaaacgcccgatgcggca
gtatttgccgaattgcagaaactggcagacttcgggcgcgatttgaacgcactcgaagaa
gcggaagaagcaacaatgatccggctgcaactggatttaatcgaatacctcaaccgcagc
cttgccgagatgaaaaaatcgcgccgcgaacgcggtttcgacgacctgctgctcgatgtc
cacaccgcgctgaccgacaatccgcacgccgaaaccctcgcccgcgccgttgccgaaaac
tgggaaaccgcgctgatcgacgagttccaagacaccgacccgctgcaatacgaaatcttc
caaaaaatcttcatcgcccaaaaccgcccgctgtttctggtcggcgatcccaaacaggcg
atttacagctttcgcggagcggacatttacgcctaccttcaggcagcggaagacgcgcgg
caccgctacacgctcgccaccaactaccgcagccacgccgcgcttatcggcagcataggc
gcactgttccgcctcaaagaacgcccgttcgttttggaaaacatcggctattcggaagtc
ggtgcggcgcgtgccgaaagcagattgtcgcccaaacgtcctgccgtacaggttcgttgg
ctgcacgaaaacgacaatgaaaaagccaacaaagacgttttgcgccgacgtgccgccgac
tattgcgccgacgaaatcgcccacgcgctcaacgaagccgccggaggccgtctgaatttc
aaaggctgcccgttgcagtcgggcgatattgccgtgctggtacgcacgcacaacgaggcg
gtgatggtttccgccgccctgaaaaaacggcaggtgcaaagcgtcctgctttcgcgcgaa
tccgtgttcgcctcgcccgaagccgccgccctgtccgcactcatcggcttctggctcgaa
ccgcgccgcgccggaacgctgcgctttgtcctgacaagcagcatattcggctataacgcg
cagcaattgcacgacttcaaccaaaacgaaagcgagattttgcattgggcggaatctgcc
cgaaccgcgctcgacaactggaatcaatacggcattttcgccgctatgcagcaattttcc
caaacacacggcatcgaaacacgcctcttaagccggaacaacgggcgcagcctgaccaac
tatttccaactgctcgaactgcttgccgccgaagacgcgcaaaaccgcaaccccgccgcg
ctgcacaaatggctgcgcgaccaaatcagcctggccggcaacaacggcggcgacaaccgc
gccatccgtctggaaagcgacgaagatttggtcaaaatcgttaccatgcacgcctcgaaa
ggtttgcagtatccgctggtgtactgcccgtttgcgtgggacgcgcaagataccgggccg
tccgactggcaaatcctccaccaaagcgcaaaccgaaccgaactgttggcaaaggcgcaa
ctgtcggaagacgaacagaagcaacacgccgacgaagaaatggcggaacgcctgcgcctg
ctttatgtcgcactgacgcgtgccgaggaacagctcaacatctacgccgcatactccacc
aataccgccgacaaccccctcgcctacctaattgaaggcttgccgcaagacagccgcgaa
accgtccgctgtgcctatgcgtgtgaaaaagacggcatcgcgatgctcaaacgcaactgg
cagcgtttgacggacaacgccccttccggcacggatttcgccttcacagaagatgtgccg
ccccctgccgtatattgcggcaatgccggtcaaaccgccgaatttgccgcaaacagcatt
cccgaacgcggattccgatttgtccgccacaccagctttaccgccttaagccgccatacc
caaacgcccgacggcggggaagaagatgcctgcccgtccttggatgccgccgaaacctcg
gtgccggcgatgccgtctgaaacgccgacggcttcagacggcatatcgatacacaacttc
ccgaaaggcacgcaggcggggctgtgcctgcacgaaattcttgaagatttcaaattcgga
caagcagccgccagacaggaaaccctcattgccgacaagctgaaaaaatacggatttgaa
gaaatatggctgcccgccgttgccgaaatggcggaagcctgccagaaaacgccgctgacg
ggggcatacggtctgtccgacatcccgcccgagtgccgctgtcccgaaatgggctttacc
ctccacaccgaagacttcggcctcaaacggctgcgcgactggtttgcccgcgacgatgtc
cggctgcccgaagtctgccgtgccgccgccgaaacgctagacttccacaccgtcaacggc
tttttaaacggctttatcgatatggtctgccaagaccccgacggcaatatctgcgtcatc
gactacaagtcgaaccacctcggcgcggacgcatccgcctacacgcaacaggcgatggac
gaagccgtcacgcaccaccactattaccttcaggcgctgatttacgccgttgccgccgca
cgctacttcaaactgcgcggacaaccgcccgccgccgtttccgtccgctacctgtttttg
cgcggattggatggcaaaggcggcggcgtttggcgttgggacatagatgccgccgctttg
gaacagataaaataa

DBGET integrated database retrieval system