KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1277Help
Entry
NMBM01240355_1277 CDS       T01947                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00010  Glycolysis / Gluconeogenesis
nms00020  Citrate cycle (TCA cycle)
nms00620  Pyruvate metabolism
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01120  Microbial metabolism in diverse environments
nms01130  Biosynthesis of antibiotics
nms01200  Carbon metabolism
Module
nms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240355_1277 (aceF)
   00020 Citrate cycle (TCA cycle)
    NMBM01240355_1277 (aceF)
   00620 Pyruvate metabolism
    NMBM01240355_1277 (aceF)
Enzymes [BR:nms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMBM01240355_1277 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Methyltr_RsmB-F DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ADY99790
Position
1345818..1347413
Genome map
AA seq 531 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKAGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAAPAAAEAQPAPAAAPVAAGGATVQVAVPDIGGHTD
VDVIAVEIKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGTAIIEV
ETAGSAAAAPAQAAQAAAPAAAPAPTAVAAPAPSAPAAAKIDEAAFAKAHAGPSARKLAR
ELGVDLGQVKGTGLKGRIVGDDIKAFVKSVMQGGAAKPAAAGASLGSSLDLLPWPKVDFS
KFGNVEVKELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWEREGVKL
SPLAFIIKASVSALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVDQKGL
KQISQELTELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGVCKSQ
IKPIWNGKEFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLAKLLKDFRRITL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccccgatatcggcggtcacgaaaacgtcgacatcatc
gccgtagaagttaaagcgggcgacaccatcgccgttgacgacaccctgattactttggaa
accgacaaagccacgatggatgtgcctgccgatgcggccggtgtcgtgaaagaagttaaa
gtcaaagtcggcgacaaaatctccgaaggcggcgtaattttgaccgttgaaaccggtgcc
gccgctgccgaagccgctcctgctgctgccgaagcacaacctgcacctgctgccgcaccc
gttgccgcaggcggtgcaaccgttcaagtagccgttcccgacatcggcggccataccgat
gtggatgtaatcgccgtcgagatcaaagtcggcgataccgttgccgaagacgacacgctg
attactttggaaaccgacaaagcaacgatggacgtaccttgtaccgctgccggtgtcgtt
aaagccgtattcttaaaagtcggcgacaaagtgtccgaaggtactgccattatcgaagta
gaaaccgccggctctgccgcagcagcccctgctcaagccgctcaagctgccgcaccggct
gccgctccggctccgactgctgtcgccgcgcctgcaccttctgcacctgccgctgccaaa
atcgacgaggccgctttcgccaaagcacacgccggcccttccgcacgcaaactggcgcgc
gaattgggcgtggatttgggccaagtcaaaggtaccggcttgaaaggccgtatcgtgggc
gacgacatcaaagcctttgtgaaatccgtaatgcagggtggcgcggcaaaacctgccgca
gccggcgcatctttgggcagcagtctggacttgctgccgtggcctaaagtggacttctcc
aaattcggcaatgtcgaagttaaagaattgtcccgcattaagaaaatctccggtcaaaac
ctgtctcgcaactgggtggtgattccccacgttaccgtacacgaagaagcagatatgacc
gagctggaagaattccgcaaacaactgaacaaagaatgggaacgcgaaggcgtgaaactg
tcaccgttggcgttcatcatcaaagcctccgtttccgcgctgaaagccttccccgaattc
aacgcttctctggacggcgacaacctggtgctgaaaaactacttcaacatcggtttcgca
gccgatacgccgaacggcttggttgttcccgtcatcaaagacgtggatcaaaaaggcttg
aaacaaatcagccaagagctgaccgaattgtccaaaaaagcccgcgaaggcaagctcaaa
ccgcaagaaatgcaaggcgcgtgctttaccatttccagcttgggcggtatcggcggcaca
ggcttcacgccgattgtaaacgctcccgaagtcgccatcttgggcgtgtgcaaatcccaa
atcaaaccgatttggaacggcaaagagtttgccccgcgcctgatgtgcccgttgagcctg
tccttcgaccaccgcgtcatcgacggtgcggccggtatgcgctttaccgtattcttggcg
aagctgttgaaagacttccgccgcattaccctgtaa

DBGET integrated database retrieval system