KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1434Help
Entry
NMV_1434          CDS       T01928                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase alpha chain (SCS-alpha)
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00020  Citrate cycle (TCA cycle)
nmt00640  Propanoate metabolism
nmt00660  C5-Branched dibasic acid metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
Module
nmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMV_1434 (sucD)
   00640 Propanoate metabolism
    NMV_1434 (sucD)
   00660 C5-Branched dibasic acid metabolism
    NMV_1434 (sucD)
Enzymes [BR:nmt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMV_1434 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CAX50266
Position
complement(1399204..1400094)
Genome map
AA seq 296 aa AA seqDB search
MSVLINKDTKVLVQGFTGKNGTFHSEQALAYGTKVVGGVTPGKGGQTHLNLPVFNTMKEA
VKETGADASVIYVPAPFVLDSIVEAVDSGVGLVVVITEGVPTLDMLKAKRYLETNGNGTR
LVGPNCPGVITPGECKIGIMPGHIHTPGRIGIISRSGTLTYEAVAQTTKLGLGQSTCIGI
GGDPIPGMNQIDALKLFQEDPDTDAIIMIGEIGGTAEEEAAEYIQSNVTKPVVGYIAGVT
APKGKRMGHAGAIISGGKGTAEEKFAAFEKAGIAYTRSPAELGTTMLEVLKTKGLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattgattaataaagacaccaaagtattggttcaaggtttcaccggtaaaaac
ggtactttccactccgaacaagctctggcttacggcactaaagttgtcggcggcgttacc
ccgggcaaaggcggtcaaacccacctaaacctgcctgtattcaacaccatgaaagaagct
gttaaagaaaccggcgcggatgcatccgtaatttacgttcccgctccgtttgtgttggat
tctatcgttgaagccgttgattcaggcgtaggcttggtcgttgtgattaccgaaggcgtg
ccgactttggacatgctcaaagccaaacgttacttggaaaccaacggcaacggtacccgc
ttggtcggccctaactgcccgggcgtgattactccgggcgagtgcaaaatcggcattatg
ccgggccacatccacactccgggccgcatcggtattatttcccgttccggtacattgact
tacgaagccgtggcacaaaccaccaaactgggcttgggtcaatcaacctgtatcggtatc
ggcggcgacccgattcctggtatgaaccaaatcgacgcactgaaacttttccaagaagac
ccggataccgacgccatcatcatgatcggtgaaatcggcggtactgcggaagaagaagca
gccgaatacatccaatccaacgtaaccaaacctgttgtaggttacattgctggtgttacc
gctcctaaaggcaaacgtatgggccacgcaggtgcgattatctccggcggtaaaggtact
gccgaggaaaaattcgccgctttcgaaaaagccggtatcgcttacacccgcagccctgcc
gagttgggcactaccatgctggaagtgttgaaaacaaaaggtttggcataa

DBGET integrated database retrieval system