KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1700Help
Entry
NMV_1700          CDS       T01928                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00260  Glycine, serine and threonine metabolism
nmt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01130  Biosynthesis of antibiotics
nmt01230  Biosynthesis of amino acids
Module
nmt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMV_1700 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMV_1700 (trpB)
Enzymes [BR:nmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMV_1700 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAX50513
Position
complement(1647710..1648912)
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGVFGEHGGLYVSETLIPALQELADAYKAAKNDPSFWEEFHRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQMLEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattaccacgcacccgacgagaagggcgttttcggcgaacacggtgggctttat
gtttccgagaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgacccgtcgttttgggaagaattccaccgcgatttgaaacactacgtcggcaggccc
agccccgtttaccatgccgcgcgattgtccgagcatttgggtggcgcgcaaatttggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgtatgggtaaaaaacgcgtcatcgccgaaactggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggtatgacttgcgacgtgtatatgggc
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaat
gtcgtcggcgttgacagcggcagccgtactttgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggatgacacattctacatcatcggtaccgccgccggtcccgcg
ccgtatcccgaaatggtgcgcgactttcaatgcgtgatcggcaatgaagccaaagaacaa
atgttggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggcgca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacactgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcattattcctgcgctggaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggcaaagaccaagtgattctggtcaac
ctatccggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system