KEGG   Nitrosospira multiformis: Nmul_A0469Help
Entry
Nmul_A0469        CDS       T00302                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00010  Glycolysis / Gluconeogenesis
nmu00030  Pentose phosphate pathway
nmu00500  Starch and sucrose metabolism
nmu00520  Amino sugar and nucleotide sugar metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A0469
   00030 Pentose phosphate pathway
    Nmul_A0469
   00500 Starch and sucrose metabolism
    Nmul_A0469
   00520 Amino sugar and nucleotide sugar metabolism
    Nmul_A0469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nmu04147]
    Nmul_A0469
Enzymes [BR:nmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Nmul_A0469
Exosome [BR:nmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nmul_A0469
  Exosomal proteins of other body fluids (saliva and urine)
   Nmul_A0469
  Exosomal proteins of colorectal cancer cells
   Nmul_A0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ABB73777
UniProt: Q2YBU4
Position
complement(523946..525586)
Genome map
AA seq 546 aa AA seqDB search
MTKPMITPLTQRPAWKALEAHYQTIKGMHLRQLFADDPKRGERFTAEAVGLYLDYSKNRI
TDETLHLLVQLAEECGLRERIEAMFRGDAINVTEQRAVLHIALRAPRNEKILVDGNDVVP
GVHAVLDRMADFSDKIRSGDWQGHTGKRIRNIINIGIGGSDLGPVMAYEALRHYSLHNLS
FRFISNVDGTDFVEATRGLDPEETLFIICSKTFTTTETLANAHTARRWMLRQIKDLEGVR
KHFVAVSTNAEEVARFGIDTANMFEFWDWVGGRYSMDSAIGLSTMIAVGPENFREMLAGF
HAMDQHFYSAPFDRNLPVLMGLLSLWYNNFFGAQTLAVLPYEQYLKRFPAYLQQLTMESN
GKHITLNGSQVDYQTSPIVWGEPGTNGQHSFYQLIHQGTRLIPCDFIGFCQTLNPLGDHH
DLLMANLFAQTEALAFGKTEDEVKAEGVPDWLCPHRSFEGNRPTNTILAERLTPHTLGAL
VALYEQSVFTQGTIWQIDSFDQWGVELGKVLAHRIGQELEDENGKSLKHDSSTNALIQRY
NRLKQK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaacccatgatcacgcccctgacgcaaaggcctgcctggaaggcactggaagcg
cactaccagacgatcaaaggcatgcatttgcgtcagctcttcgctgacgatccgaagcgg
ggtgagcgatttacggccgaggccgtcggcctgtacctggattattcgaaaaatcgcatc
actgatgaaacgcttcatctactggtgcagcttgccgaagaatgcggcctgcgcgagcgc
attgaagccatgttcaggggtgacgccatcaatgtgacagaacagcgtgctgtactccac
atcgccttgcgcgcgcctcgtaatgaaaaaatcctcgtcgacggaaatgacgttgtgccc
ggggtgcatgccgtgctcgaccgtatggcggatttctccgacaagatacgcagcggggac
tggcaggggcatactggcaagcgaattcgcaatatcatcaatatcggtatcggcggctcc
gatctgggcccggtgatggcgtatgaagcgctgcgccactacagtctgcacaatctcagc
tttcgtttcatctccaatgttgatggcacggatttcgtggaggctacacgaggtcttgat
cccgaagaaaccctgttcattatctgctccaagacattcacgacaacggaaacgctggcc
aatgcccacaccgcccggcggtggatgctgcgacagataaaggacctggagggggtgcgc
aagcacttcgtcgctgtttccaccaatgcggaggaagtagccagattcggcatcgatacc
gccaacatgttcgaattctgggactgggtaggtggacgctattccatggactccgcgatc
ggactctcaaccatgattgccgtcggcccagagaatttccgtgagatgcttgccggcttc
catgcaatggaccagcacttctattccgctccgttcgacaggaatcttcctgtcctgatg
ggattgctgtcgctctggtataacaatttctttggcgcgcagacactcgccgtactgccc
tacgagcaatatttgaagcgctttccggcttacctccagcaactgacaatggagagcaat
ggaaagcacattacactgaatggctcccaggttgactaccagacctcacctatcgtgtgg
ggagaacccggcaccaacggacaacattcgttttaccagctcatccatcagggaacccga
ttgattccctgtgattttatcggcttctgccaaaccctgaaccccttgggcgatcaccat
gacctcctcatggcgaatctgtttgcccagaccgaggcgcttgctttcggaaaaacggaa
gatgaagtcaaagctgaaggtgtcccggactggctttgcccgcatcgcagttttgagggg
aatcgccccaccaatacgatacttgccgagcgcctcacaccccacaccctcggtgccctt
gtcgctctttatgagcagagtgtttttacacaggggacaatctggcagatcgattcgttc
gatcaatggggcgtcgaactcggcaaagtgctggcacaccgcatcgggcaggaactggag
gatgaaaacggcaagtccctgaaacatgatagctccaccaacgccctgatacagcggtac
aacaggctgaaacaaaaatag

DBGET integrated database retrieval system