KEGG   Nitrosospira multiformis: Nmul_A0862Help
Entry
Nmul_A0862        CDS       T00302                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00020  Citrate cycle (TCA cycle)
nmu00190  Oxidative phosphorylation
nmu00650  Butanoate metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmul_A0862
   00650 Butanoate metabolism
    Nmul_A0862
  Energy metabolism
   00190 Oxidative phosphorylation
    Nmul_A0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABB74165
UniProt: Q2YAQ6
Position
complement(981523..981885)
Genome map
AA seq 120 aa AA seqDB search
MVKRPVRAITGAHYGLRDWLAQRVTAAVMAIYILMLAGVLLVSPPQDYASFKTLFDNQWM
RVASFLFLLSLFWHAWIGMRNILMDYVHPAGIRLILEILVILSLLSYAIWSVEILWIGEG
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcgtccagtgcgggcgataaccggggcgcattacgggcttcgcgactggctg
gcgcaacgcgtcaccgccgcggtaatggccatctatatcctgatgctggcaggggtgctg
ctggtttcccccccgcaggactacgcgtccttcaagacactgttcgataaccagtggatg
cgggtagcatccttcctgtttcttctgagcctgttctggcatgcatggatcggaatgcgc
aacatactgatggattacgttcatcctgctggtatccgcctcattctggaaatactggtc
atactgtcactgctgtcttatgccatctggtctgtggaaattctctggataggtgaagga
tag

DBGET integrated database retrieval system