KEGG   Nitrosospira multiformis: Nmul_A1394Help
Entry
Nmul_A1394        CDS       T00302                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00010  Glycolysis / Gluconeogenesis
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1394
Enzymes [BR:nmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Nmul_A1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Hpr_kinase_N
Motif
Other DBs
NCBI-ProteinID: ABB74697
UniProt: Q2Y974
Position
complement(1589682..1590608)
Genome map
AA seq 308 aa AA seqDB search
MNIEELNKNHGIDGQVKFMEGAGGFPFIRVDNAKGGAVISVYGGQVLSFQPANEQNLMFL
SEAAYYEAGKGIKGGAPVCWPWFGPDPQQQGRPVHGFVRTRLWNVIKTETTGNGDSKVTL
GLSDTAETRAIWPHAFDLDLEVTVGNSLNLELITRNKDTAPFSITQALHTYFKVGHIDRI
TILGLEGVSYLDKVDNYAQKTQAGAITINSEVDRIYQDVQKELVIDDTAYDRRIRIQSSD
SRTAVVWNPWARISAQMGDLKDDDYEHFVCVETANAGSEVVEVAAGGECRVAANYLIERN
IPELKPAA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagaagagttgaataaaaaccatgggatcgacgggcaggtcaaattcatggag
ggggcaggagggttcccctttatcagggtcgataatgccaagggtggcgcagtgatctct
gtttatggagggcaggtactatcttttcaacctgcaaatgagcagaacctgatgttcctg
agcgaggctgcatattatgaggcaggtaaaggtatcaagggcggcgctcccgtctgctgg
ccttggttcggcccggatccgcaacagcaagggcgtcctgtacatggttttgtgcgtacc
cgcctctggaacgtcattaaaacggaaaccactggaaatggcgacagcaaggtgacgctc
ggtttgagcgatacagcggaaacaagggcgatctggccgcatgcgttcgatctggatctc
gaagttacagtgggaaactccctgaatctggaattgatcacgcgaaataaagataccgcg
cctttttcaatcacgcaggctttgcatacctatttcaaggtcgggcatatcgatcgcatc
accattctcggtctcgagggggtctcgtatctcgataaagtcgacaactacgctcaaaaa
acccaggcaggtgcaataacgatcaattccgaagtcgatcgcatttaccaagatgtgcag
aaagagttggtgatcgacgataccgcttatgatcgccggattcgcattcaatcgagcgac
agcaggactgctgtcgtatggaatccctgggcgagaatttctgcccagatgggcgacctg
aaggatgacgactacgaacactttgtgtgcgttgaaaccgcgaatgctgggtcagaagtg
gtggaagttgctgccggcggggaatgcagagtagctgcgaactatctgatagagcgaaat
attccggagctgaaaccggctgcttga

DBGET integrated database retrieval system