KEGG   Nitrosospira multiformis: Nmul_A1843Help
Entry
Nmul_A1843        CDS       T00302                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00330  Arginine and proline metabolism
nmu00332  Carbapenem biosynthesis
nmu01100  Metabolic pathways
nmu01130  Biosynthesis of antibiotics
nmu01230  Biosynthesis of amino acids
Module
nmu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Nmul_A1843
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Nmul_A1843
Enzymes [BR:nmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Nmul_A1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA PUA_3
Motif
Other DBs
NCBI-ProteinID: ABB75138
UniProt: Q2Y7Y3
Position
2127049..2128167
Genome map
AA seq 372 aa AA seqDB search
MESVLKQSRRIVVKVGSSLVTNQGQGLDHSALAHWAGQIVKLKKTGKEVVLVSSGAIAEG
MQRLKWKKRPHAVHELQAAAAVGQMGLVQAYETCFRKHELHSAQILLTHEDLSDRKRYLN
ARSTLATLLDLNVIPIINENDTVATDEIRFGDNDTLAALVTNLIEADVLVILTDQRGLFT
ADPRKDTQAKLVEQAKAGDADIERMAGGAGSEIGRGGMLTKVLAAKRAARSGAHTVIASG
READVLIRLARGEAIGTQLLAETMTLAARKQWLADHLQIRGNVTLDEGAVEALAVGGKSL
LPVGVTDVRGNFERGEVVGCLDPHGREIARGLVNYNAAETRRILRRASDEIESLLGYIGE
PELIHRDNLVLL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttttaaagcagtcgcggcgcattgtcgtcaaggtcggcagcagcctggta
acgaaccagggacaaggccttgaccattcggcgctcgcgcactgggctggacaaatcgtt
aaactcaagaagaccggcaaggaagtggtactcgtttcttccggggccatagcggaggga
atgcaacgcctgaaatggaaaaagcgcccccacgcggtccatgaattgcaggcggcagcg
gcggtgggacaaatgggcctggtgcaggcctatgaaacctgcttccgcaagcatgaattg
cactcggcccagattttgctcacccacgaagacttgtccgaccgcaagcgctatctgaac
gcacgctccacgctggccacgctgttggatctgaatgtcattccaatcatcaatgaaaat
gatacggtagcaaccgatgaaatccgcttcggcgataacgatacgctagccgcactggta
accaacctgatcgaggcggatgttctggtaattctaaccgatcagcgagggttattcaca
gccgatccgcgaaaagatacccaggcgaaactggtggagcaagcaaaagccggagacgcg
gacatcgaacggatggcggggggggcaggcagcgaaataggacggggcggcatgttgacc
aaggtgctggcggccaaacgcgcagcgagaagcggcgcgcacacggtgattgcgtcggga
cgcgaagcggatgtcttgattcgcctcgcccgaggggaagcaatcggcacccagttgctg
gcggaaaccatgacgcttgccgctcgcaagcagtggctggcggaccatctgcaaatccgg
ggaaatgtcacgctggacgaaggagcggtggaagcactggccgttggcggcaaaagtctt
ctgccggtcggcgtgaccgatgtgcgcggcaacttcgaacggggtgaagtcgtaggctgc
ctcgatccgcacggaagggaaatcgctcgcggactggtcaattacaatgctgcggaaacc
cggcgtattctccgccgggcaagcgacgaaatcgaaagccttctcggctatattggtgaa
ccggagctcatccacagggataacctggttctgctttaa

DBGET integrated database retrieval system